Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TRH Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Rabbit TRH Polyclonal Antibody | anti-TRH antibody

TRH antibody - C-terminal region

Gene Names
TRH; TRF; Pro-TRH
Reactivity
Cow, Guinea Pig, Human, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRH; Polyclonal Antibody; TRH antibody - C-terminal region; anti-TRH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Zebrafish
Clonality
Polyclonal
Specificity
This antibody is directed towards the pro-hormone form of TRH, not the processed tripeptide.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
Sequence Length
242
Applicable Applications for anti-TRH antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 84%; Human: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TRH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TRH Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-TRH Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-TRH antibody
This is a rabbit polyclonal antibody against TRH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRH functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
thyrotropin releasing hormone preproprotein
NCBI Official Synonym Full Names
thyrotropin releasing hormone
NCBI Official Symbol
TRH
NCBI Official Synonym Symbols
TRF; Pro-TRH
NCBI Protein Information
thyrotropin releasing hormone
UniProt Protein Name
Pro-thyrotropin-releasing hormone
UniProt Gene Name
TRH
UniProt Synonym Gene Names
Pro-TRH; TRH; TRF
UniProt Entry Name
TRH_HUMAN

NCBI Description

This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. [provided by RefSeq, May 2013]

Uniprot Description

TRH: Functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems. May promote hair shaft elongation, prolonge the hair cycle growth phase (anagen) and antagonized its termination by TGFB2. May also increase proliferation and inhibited apoptosis of hair matrix keratinocytes. Belongs to the TRH family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3q13.3-q21

Cellular Component: extracellular region; plasma membrane; nucleus; secretory granule

Molecular Function: neuropeptide hormone activity; thyrotropin-releasing hormone activity

Biological Process: negative regulation of glutamate secretion; hormone-mediated signaling; eating behavior; positive regulation of insulin secretion; histamine metabolic process; signal transduction; adult walking behavior; response to ethanol; cell-cell signaling; response to glucose stimulus; response to hypoxia; response to cold; response to corticosterone stimulus; positive regulation of gamma-aminobutyric acid secretion

Disease: Thyrotropin-releasing Hormone Deficiency

Research Articles on TRH

Similar Products

Product Notes

The TRH trh (Catalog #AAA3224527) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRH antibody - C-terminal region reacts with Cow, Guinea Pig, Human, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TRH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRH trh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RALGGPCGPQ GAYGQAGLLL GLLDDLSRSQ GAEEKRQHPG RRAAWVREPL. It is sometimes possible for the material contained within the vial of "TRH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.