Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GAL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293TGAL is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit anti-Dog, Human GAL Polyclonal Antibody | anti-GAL antibody

GAL antibody - middle region

Gene Names
GAL; ETL8; GALN; GLNN; GMAP; GAL-GMAP
Reactivity
Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GAL; Polyclonal Antibody; GAL antibody - middle region; anti-GAL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN
Sequence Length
123
Applicable Applications for anti-GAL antibody
Western Blot (WB)
Homology
Dog: 76%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GAL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GAL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293TGAL is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-GAL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293TGAL is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-GAL antibody
This is a rabbit polyclonal antibody against GAL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
galanin peptides preproprotein
NCBI Official Synonym Full Names
galanin and GMAP prepropeptide
NCBI Official Symbol
GAL
NCBI Official Synonym Symbols
ETL8; GALN; GLNN; GMAP; GAL-GMAP
NCBI Protein Information
galanin peptides
UniProt Protein Name
Galanin peptides
Protein Family
UniProt Gene Name
GAL
UniProt Synonym Gene Names
GAL1; GALN; GLNN; GMAP
UniProt Entry Name
GALA_HUMAN

NCBI Description

This gene encodes a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically processed to generate two mature peptides: galanin and galanin message-associated peptide (GMAP). Galanin has diverse physiological functions including nociception, feeding and energy homeostasis, osmotic regulation and water balance. GMAP has been demonstrated to possess antifungal activity and hypothesized to be part of the innate immune system. [provided by RefSeq, Jul 2015]

Uniprot Description

Galanin: Contracts smooth muscle of the gastrointestinal and genitourinary tract, regulates growth hormone release, modulates insulin release, and may be involved in the control of adrenal secretion. Belongs to the galanin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11q13.3

Cellular Component: Golgi apparatus; extracellular space; cell soma; extracellular region; secretory granule

Molecular Function: type 3 galanin receptor binding; neuropeptide hormone activity; protein binding; type 2 galanin receptor binding; type 1 galanin receptor binding

Biological Process: response to drug; nervous system development; positive regulation of cortisol secretion; positive regulation of apoptosis; positive regulation of catagen; negative regulation of lymphocyte proliferation; response to insulin stimulus; cAMP-mediated signaling; response to estrogen stimulus; insulin secretion; neuropeptide signaling pathway; regulation of glucocorticoid metabolic process; positive regulation of transcription from RNA polymerase II promoter; feeding behavior; inflammatory response

Disease: Epilepsy, Familial Temporal Lobe, 8

Research Articles on GAL

Similar Products

Product Notes

The GAL gal (Catalog #AAA3224490) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAL antibody - middle region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GAL gal for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNSAGYLLGP HAVGNHRSFS DKNGLTSKRE LRPEDDMKPG SFDRSIPENN. It is sometimes possible for the material contained within the vial of "GAL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.