Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TPSAB1 rabbit polyclonal antibody. Western Blot analysis of TPSAB1 expression in human colon.)

Rabbit anti-Human TPSAB1 Polyclonal Antibody | anti-TPSAB1 antibody

TPSAB1 (TPS1, TPS2, TPSB1, Tryptase alpha/beta-1, Tryptase I, Tryptase alpha-1) (PE)

Gene Names
TPSAB1; TPS1; TPS2; TPSB1; TPSB2; Tryptase-2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TPSAB1; Polyclonal Antibody; TPSAB1 (TPS1; TPS2; TPSB1; Tryptase alpha/beta-1; Tryptase I; Tryptase alpha-1) (PE); anti-TPSAB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TPSAB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1166
Applicable Applications for anti-TPSAB1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TPSAB1, aa1-275 (NP_003285.2).
Immunogen Sequence
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TPSAB1 rabbit polyclonal antibody. Western Blot analysis of TPSAB1 expression in human colon.)

Western Blot (WB) (TPSAB1 rabbit polyclonal antibody. Western Blot analysis of TPSAB1 expression in human colon.)

Western Blot (WB)

(Western Blot analysis of TPSAB1 expression in transfected 293T cell line by TPSAB1 polyclonal antibody. Lane 1: TPSAB1 transfected lysate (30.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TPSAB1 expression in transfected 293T cell line by TPSAB1 polyclonal antibody. Lane 1: TPSAB1 transfected lysate (30.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TPSAB1 antibody
Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, alpha and beta 1. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders.
Product Categories/Family for anti-TPSAB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens tryptase alpha/beta 1 (TPSAB1), mRNA
NCBI Official Synonym Full Names
tryptase alpha/beta 1
NCBI Official Symbol
TPSAB1
NCBI Official Synonym Symbols
TPS1; TPS2; TPSB1; TPSB2; Tryptase-2
NCBI Protein Information
tryptase alpha/beta-1
UniProt Protein Name
Tryptase alpha/beta-1
Protein Family
UniProt Gene Name
TPSAB1
UniProt Synonym Gene Names
TPS1; TPS2; TPSB1; Tryptase-1
UniProt Entry Name
TRYB1_HUMAN

NCBI Description

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, alpha and beta 1. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq, Jul 2008]

Uniprot Description

TPSAB1: Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. Belongs to the peptidase S1 family. Tryptase subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.21.59; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: extracellular matrix; extracellular space; extracellular region

Molecular Function: protein binding; serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: extracellular matrix disassembly; extracellular matrix organization and biogenesis; defense response; proteolysis

Research Articles on TPSAB1

Similar Products

Product Notes

The TPSAB1 tpsab1 (Catalog #AAA6397005) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPSAB1 (TPS1, TPS2, TPSB1, Tryptase alpha/beta-1, Tryptase I, Tryptase alpha-1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TPSAB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TPSAB1 tpsab1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TPSAB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.