Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TPCN1 antibody (MBS5300733) used at 1 ug/ml to detect target protein.)

Rabbit TPCN1 Polyclonal Antibody | anti-TPCN1 antibody

TPCN1 antibody

Gene Names
TPCN1; TPC1
Applications
Western Blot
Purity
Affinity purified
Synonyms
TPCN1; Polyclonal Antibody; TPCN1 antibody; Polyclonal TPCN1; Anti-TPCN1; KIAA1169; TPCN 1; TPC1; Two Pore Segment Channel 1; TPCN-1; FLJ20612; anti-TPCN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
TPCN1 antibody was raised against the N terminal of TPCN1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPCN1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
618
Applicable Applications for anti-TPCN1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6.
Cross-Reactivity
Human
Immunogen
TPCN1 antibody was raised using the N terminal of TPCN1 corresponding to a region with amino acids YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(TPCN1 antibody (MBS5300733) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (TPCN1 antibody (MBS5300733) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TPCN1 antibody
Rabbit polyclonal TPCN1 antibody raised against the N terminal of TPCN1
Product Categories/Family for anti-TPCN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
94 kDa (MW of target protein)
NCBI Official Full Name
TPCN1 protein
NCBI Official Synonym Full Names
two pore segment channel 1
NCBI Official Symbol
TPCN1
NCBI Official Synonym Symbols
TPC1
NCBI Protein Information
two pore calcium channel protein 1
UniProt Protein Name
Two pore calcium channel protein 1
UniProt Gene Name
TPCN1
UniProt Synonym Gene Names
KIAA1169; TPC1
UniProt Entry Name
TPC1_HUMAN

NCBI Description

Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]).[supplied by OMIM, Mar 2008]

Uniprot Description

TPCN1: one of the major voltage-gated Ca(2+) channel (VDCC) across the plasma membrane. Highest expression found in the heart and kidney, and lowest expression found in the spleen. Each of the two internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position. Two alternatively spliced human isoforms have been described.

Protein type: Membrane protein, multi-pass; Channel, calcium; Transporter; Membrane protein, integral; Transporter, ion channel

Chromosomal Location of Human Ortholog: 12q24.13

Cellular Component: lysosomal membrane; integral to membrane; plasma membrane; endosome membrane

Molecular Function: voltage-gated calcium channel activity; identical protein binding; protein binding

Biological Process: calcium ion transport; transmembrane transport

Research Articles on TPCN1

Similar Products

Product Notes

The TPCN1 tpcn1 (Catalog #AAA5300733) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TPCN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TPCN1 tpcn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TPCN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.