Western Blot (WB)
(WB Suggested Anti-SPINT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Rabbit SPINT2 Polyclonal Antibody | anti-SPINT2 antibody
SPINT2 antibody - middle region
Gene Names
SPINT2; PB; Kop; HAI2; DIAR3; HAI-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SPINT2; Polyclonal Antibody; SPINT2 antibody - middle region; anti-SPINT2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK
Sequence Length
195
Applicable Applications for anti-SPINT2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SPINT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SPINT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SPINT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Related Product Information for anti-SPINT2 antibody
This is a rabbit polyclonal antibody against SPINT2. It was validated on Western Blot
Target Description: HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the KD-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.
Target Description: HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the KD-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.
Product Categories/Family for anti-SPINT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19kDa
NCBI Official Full Name
kunitz-type protease inhibitor 2 isoform b
NCBI Official Synonym Full Names
serine peptidase inhibitor, Kunitz type 2
NCBI Official Symbol
SPINT2
NCBI Official Synonym Symbols
PB; Kop; HAI2; DIAR3; HAI-2
NCBI Protein Information
kunitz-type protease inhibitor 2
Protein Family
NCBI Description
This gene encodes a transmembrane protein with two extracellular Kunitz domains that inhibits a variety of serine proteases. The protein inhibits HGF activator which prevents the formation of active hepatocyte growth factor. This gene is a putative tumor suppressor, and mutations in this gene result in congenital sodium diarrhea. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Research Articles on SPINT2
Similar Products
Product Notes
The SPINT2 (Catalog #AAA3214211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPINT2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SPINT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPINT2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RWYFDVERNS CNNFIYGGCR GNKNSYRSEE ACMLRCFRQQ ENPPLPLGSK. It is sometimes possible for the material contained within the vial of "SPINT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
