Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TPCN1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Rabbit TPCN1 Polyclonal Antibody | anti-TPCN1 antibody

TPCN1 antibody - N-terminal region

Gene Names
TPCN1; TPC1
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TPCN1; Polyclonal Antibody; TPCN1 antibody - N-terminal region; anti-TPCN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
Sequence Length
816
Applicable Applications for anti-TPCN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TPCN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TPCN1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TPCN1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TPCN1Sample Type: HT1080Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TPCN1Sample Type: HT1080Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-TPCN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-TPCN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)

Western Blot (WB)

(Host: RabbitTarget Name: TPCN1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TPCN1Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-TPCN1 antibody
This is a rabbit polyclonal antibody against TPCN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]).[supplied by OMIM].
Product Categories/Family for anti-TPCN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
two pore calcium channel protein 1 isoform 2
NCBI Official Synonym Full Names
two pore segment channel 1
NCBI Official Symbol
TPCN1
NCBI Official Synonym Symbols
TPC1
NCBI Protein Information
two pore calcium channel protein 1
UniProt Protein Name
Two pore calcium channel protein 1
UniProt Gene Name
TPCN1
UniProt Synonym Gene Names
KIAA1169; TPC1
UniProt Entry Name
TPC1_HUMAN

NCBI Description

Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6 (Ishibashi et al., 2000 [PubMed 10753632]).[supplied by OMIM, Mar 2008]

Uniprot Description

TPCN1: one of the major voltage-gated Ca(2+) channel (VDCC) across the plasma membrane. Highest expression found in the heart and kidney, and lowest expression found in the spleen. Each of the two internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position. Two alternatively spliced human isoforms have been described.

Protein type: Membrane protein, integral; Transporter, ion channel; Transporter; Membrane protein, multi-pass; Channel, calcium

Chromosomal Location of Human Ortholog: 12q24.13

Cellular Component: endosome; endosome membrane; integral to membrane; lysosomal membrane; lysosome; plasma membrane

Molecular Function: identical protein binding; protein binding; voltage-gated calcium channel activity

Biological Process: positive regulation of autophagy; release of sequestered calcium ion into cytosol

Research Articles on TPCN1

Similar Products

Product Notes

The TPCN1 tpcn1 (Catalog #AAA3202509) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPCN1 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TPCN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TPCN1 tpcn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YQEAAIYLQE GENNDKFFTH PKDAKALAAY LFAHNHLFYL MELATALLLL. It is sometimes possible for the material contained within the vial of "TPCN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.