Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TP73Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Rabbit TP73 Polyclonal Antibody | anti-TP73 antibody

TP73 antibody - middle region

Gene Names
TP73; P73
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TP73; Polyclonal Antibody; TP73 antibody - middle region; anti-TP73 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRSFEGRICACPGRDRKADEDHYREQQALNESSAKNGAASKRAFKQSPPA
Sequence Length
636
Applicable Applications for anti-TP73 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TP73
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TP73Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TP73Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: TP73Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TP73Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TP73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysate)

Western Blot (WB) (WB Suggested Anti-TP73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysate)
Related Product Information for anti-TP73 antibody
This is a rabbit polyclonal antibody against TP73. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TP73 belongs to the p53 family. It participates in the apoptotic response to DNA damage. When overproduced, it activates transcription from p53-responsive promoters and induces apoptosis. TP53 may be a tumor suppressor protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
tumor protein p73 isoform a
NCBI Official Synonym Full Names
tumor protein p73
NCBI Official Symbol
TP73
NCBI Official Synonym Symbols
P73
NCBI Protein Information
tumor protein p73
UniProt Protein Name
Tumor protein p73
Protein Family
UniProt Gene Name
TP73
UniProt Synonym Gene Names
P73
UniProt Entry Name
P73_HUMAN

NCBI Description

This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined. [provided by RefSeq, Feb 2011]

Uniprot Description

p73: a protein of the p53 family of proteins. p73, like p53, may have tumor suppressor activity, but its multiple isoforms possess different and sometimes opposing functions. Participates in the apoptotic response to DNA damage. Phosphorylated in a cell cycle-dependent manner and negatively regulated by CDKs. When overproduced, activates transcription from p53-responsive promoters and induces apoptosis. Nine transactivation competent (TA) or dominant negative (DN) isoforms, derived from alternative-splicing and alternative promoters, have been described. NH2-terminally truncated p73 isoforms (DNp73) may be oncogenic. DNp73 is elevated in a number of cancers and is associated with adverse clinical outcomes and resistance to chemotherapy. The C-terminal oligomerization domain binds to the ABL1 tyrosine kinase SH3 domain. Isoform Beta interacts homotypically and with p53/TP53, whereas isoform Alpha does not. Isoform Gamma interacts homotypically and with all p73 isoforms. Isoform Delta interacts with isoform Gamma, isoform Alpha, and homotypically. Isoforms Alpha and Beta interact with HIPK2. Isoform Alpha interacts with RANBP9; forms complex with p53 and CABLES1. Isoform Beta interacts with WWOX; interacts with HECW2.

Protein type: Tumor suppressor; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 1p36.3

Cellular Component: nucleoplasm; Golgi apparatus; transcription factor complex; intracellular membrane-bound organelle; cell junction; chromatin; cytosol; nucleus

Molecular Function: identical protein binding; protein binding; p53 binding; metal ion binding; double-stranded DNA binding; damaged DNA binding; chromatin binding; transcription factor activity; transcription factor binding; protein kinase binding

Biological Process: transcription from RNA polymerase II promoter; G1 DNA damage checkpoint; cerebrospinal fluid secretion; positive regulation of cell size; activation of MAPK activity; positive regulation of transcription, DNA-dependent; regulation of mitotic cell cycle; negative regulation of transcription from RNA polymerase II promoter; post-embryonic development; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; negative regulation of cardiac muscle cell proliferation; response to gamma radiation; positive regulation of oligodendrocyte differentiation; negative regulation of neuron apoptosis; cell cycle arrest; kidney development; inflammatory response; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; protein tetramerization; response to X-ray; negative regulation of JNK activity; release of cytochrome c from mitochondria; mismatch repair; hippocampus development; digestive tract morphogenesis; response to organic nitrogen; negative regulation of neuron differentiation; DNA damage response, signal transduction resulting in induction of apoptosis; regulation of gene expression; neuron development; positive regulation of transcription from RNA polymerase II promoter; response to DNA damage stimulus

Research Articles on TP73

Similar Products

Product Notes

The TP73 tp73 (Catalog #AAA3201539) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TP73 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TP73 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TP73 tp73 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRSFEGRICA CPGRDRKADE DHYREQQALN ESSAKNGAAS KRAFKQSPPA. It is sometimes possible for the material contained within the vial of "TP73, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.