Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Mouse anti-Human CA7 Monoclonal Antibody | anti-CA7 antibody

CA7 (Carbonic Anhydrase 4, Carbonic Anhydrase IV, CA-IV, Carbonate Dehydratase IV) (PE)

Gene Names
CA7; CAVII; CA-VII
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CA7; Monoclonal Antibody; CA7 (Carbonic Anhydrase 4; Carbonic Anhydrase IV; CA-IV; Carbonate Dehydratase IV) (PE); anti-CA7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B7
Specificity
Recognizes human CA7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CA7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa34-125 from human CA7 (NP_005173) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVH*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.12kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.12kD).)

Western Blot (WB)

(CA7 monoclonal antibody Western Blot analysis of CA7 expression in Hela NE.)

Western Blot (WB) (CA7 monoclonal antibody Western Blot analysis of CA7 expression in Hela NE.)
Related Product Information for anti-CA7 antibody
CA4 is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This protein is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and proximal renal tubules. Its exact function is not known; however, the protein may have a role in inherited renal abnormalities of bicarbonate transport.
Product Categories/Family for anti-CA7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
766
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
carbonic anhydrase 7 isoform 1
NCBI Official Synonym Full Names
carbonic anhydrase 7
NCBI Official Symbol
CA7
NCBI Official Synonym Symbols
CAVII; CA-VII
NCBI Protein Information
carbonic anhydrase 7
UniProt Protein Name
Carbonic anhydrase 7
Protein Family
UniProt Gene Name
CA7
UniProt Entry Name
CAH7_HUMAN

NCBI Description

Carbonic anhydrases are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. The cytosolic protein encoded by this gene is predominantly expressed in the brain and contributes to bicarbonate driven GABAergic neuron excitation. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2018]

Research Articles on CA7

Similar Products

Product Notes

The CA7 ca7 (Catalog #AAA6156822) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CA7 (Carbonic Anhydrase 4, Carbonic Anhydrase IV, CA-IV, Carbonate Dehydratase IV) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CA7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CA7 ca7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CA7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.