Western Blot (WB)
(WB Suggested Anti-TOR1AIP2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Rabbit TOR1AIP2 Polyclonal Antibody | anti-TOR1AIP2 antibody
TOR1AIP2 Antibody - N-terminal region
Gene Names
TOR1AIP2; NET9; LULL1; IFRG15
Reactivity
Dog, Horse, Human, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TOR1AIP2; Polyclonal Antibody; TOR1AIP2 Antibody - N-terminal region; anti-TOR1AIP2 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPS
Sequence Length
470
Applicable Applications for anti-TOR1AIP2 antibody
Western Blot (WB)
Homology
Dog: 83%; Horse: 79%; Human: 100%; Rat: 100%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TOR1AIP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TOR1AIP2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Western Blot (WB)
(WB Suggested Anti-TOR1AIP2 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-TOR1AIP2 antibody
This is a rabbit polyclonal antibody against TOR1AIP2. It was validated on Western Blot
Target Description: TOR1AIP2 regulates the distribution of TOR1A between the endoplasmic reticulum and the nuclear envelope.
Target Description: TOR1AIP2 regulates the distribution of TOR1A between the endoplasmic reticulum and the nuclear envelope.
Product Categories/Family for anti-TOR1AIP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51kDa
NCBI Official Full Name
torsin-1A-interacting protein 2 isoform b
NCBI Official Synonym Full Names
torsin 1A interacting protein 2
NCBI Official Symbol
TOR1AIP2
NCBI Official Synonym Symbols
NET9; LULL1; IFRG15
NCBI Protein Information
torsin-1A-interacting protein 2; interferon alpha responsive protein
UniProt Protein Name
Torsin-1A-interacting protein 2
Protein Family
UniProt Gene Name
TOR1AIP2
UniProt Synonym Gene Names
IFRG15; LULL1
UniProt Entry Name
TOIP2_HUMAN
NCBI Description
One of the two protein isoforms encoded by this gene is a type II integral membrane protein found in the endoplasmic reticulum (ER). The encoded protein is a cofactor for the ATPase TorsinA, regulating the amount of TorsinA present in the ER compared to that found in the nuclear envelope. Defects in this protein are a cause of early onset primary dystonia, a neuromuscular disease. The other isoform encoded by this gene is an interferon alpha responsive protein whose cellular role has yet to be determined. [provided by RefSeq, Mar 2017]
Research Articles on TOR1AIP2
Similar Products
Product Notes
The TOR1AIP2 tor1aip2 (Catalog #AAA3217211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOR1AIP2 Antibody - N-terminal region reacts with Dog, Horse, Human, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TOR1AIP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOR1AIP2 tor1aip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDEANVGKHP KDKTEDENKQ SFLDGGKGHH LPSENLGKEP LDPDPSHSPS. It is sometimes possible for the material contained within the vial of "TOR1AIP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
