Western Blot (WB)
(WB Suggested Anti-C1RL AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Rabbit anti-Human, Mouse C1RL Polyclonal Antibody | anti-C1RL antibody
C1RL Antibody - middle region
Gene Names
C1RL; C1RL1; C1RLP; CLSPa; C1r-LP
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C1RL; Polyclonal Antibody; C1RL Antibody - middle region; anti-C1RL antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVQNHCQEPYYQAAAAGALTCATPGTWKDRQDGEEVLQCMPVCGRPVTPI
Sequence Length
487
Applicable Applications for anti-C1RL antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human C1RL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C1RL AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Western Blot (WB)
(WB Suggested Anti-C1RL AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-C1RL antibody
This is a rabbit polyclonal antibody against C1RL. It was validated on Western Blot
Target Description: C1RL mediates the proteolytic cleavage of HP/haptoglobin in the endoplasmic reticulum.
Target Description: C1RL mediates the proteolytic cleavage of HP/haptoglobin in the endoplasmic reticulum.
Product Categories/Family for anti-C1RL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
complement C1r subcomponent-like protein isoform 1
NCBI Official Synonym Full Names
complement C1r subcomponent like
NCBI Official Symbol
C1RL
NCBI Official Synonym Symbols
C1RL1; C1RLP; CLSPa; C1r-LP
NCBI Protein Information
complement C1r subcomponent-like protein
UniProt Protein Name
Complement C1r subcomponent-like protein
Protein Family
UniProt Gene Name
C1RL
UniProt Synonym Gene Names
C1RL1; C1RLP; CLSPA
UniProt Entry Name
C1RL_HUMAN
Uniprot Description
C1RL: Mediates the proteolytic cleavage of HP/haptoglobin in the endoplasmic reticulum. Belongs to the peptidase S1 family.
Protein type: Secreted; Protease; EC 3.4.21.-; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 12p13.31
Cellular Component: extracellular space
Molecular Function: serine-type endopeptidase activity
Biological Process: innate immune response; proteolysis; complement activation, classical pathway
Research Articles on C1RL
Similar Products
Product Notes
The C1RL c1rl (Catalog #AAA3217469) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1RL Antibody - middle region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's C1RL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C1RL c1rl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVQNHCQEPY YQAAAAGALT CATPGTWKDR QDGEEVLQCM PVCGRPVTPI. It is sometimes possible for the material contained within the vial of "C1RL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
