Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TNIP3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Rabbit anti-Human TNIP3 Polyclonal Antibody | anti-TNIP3 antibody

TNIP3 Antibody - N-terminal region

Gene Names
TNIP3; LIND; ABIN-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNIP3; Polyclonal Antibody; TNIP3 Antibody - N-terminal region; anti-TNIP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL
Sequence Length
256
Applicable Applications for anti-TNIP3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TNIP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNIP3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)

Western Blot (WB) (WB Suggested Anti-TNIP3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Lung)
Related Product Information for anti-TNIP3 antibody
This is a rabbit polyclonal antibody against TNIP3. It was validated on Western Blot

Target Description: TNIP3 binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.
Product Categories/Family for anti-TNIP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
unnamed protein product
NCBI Official Synonym Full Names
TNFAIP3 interacting protein 3
NCBI Official Symbol
TNIP3
NCBI Official Synonym Symbols
LIND; ABIN-3
NCBI Protein Information
TNFAIP3-interacting protein 3
UniProt Protein Name
TNFAIP3-interacting protein 3
UniProt Gene Name
TNIP3
UniProt Synonym Gene Names
ABIN-3
UniProt Entry Name
TNIP3_HUMAN

Uniprot Description

TNIP3: Binds to zinc finger protein TNFAIP3 and inhibits NF- kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13- acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 4q27

Molecular Function: polyubiquitin binding

Biological Process: MyD88-independent toll-like receptor signaling pathway; negative regulation of I-kappaB kinase/NF-kappaB cascade; inflammatory response; toll-like receptor 4 signaling pathway

Research Articles on TNIP3

Similar Products

Product Notes

The TNIP3 tnip3 (Catalog #AAA3216970) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNIP3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNIP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNIP3 tnip3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YERKVAELKT KLDAAERFLS TREKDPHQRQ RKDDRQREDD RQRDLTRDRL. It is sometimes possible for the material contained within the vial of "TNIP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.