Rabbit TNIP1 Polyclonal Antibody | anti-TNIP1 antibody

TNIP1 antibody - C-terminal region

Cat. Num. AAA3215314

• Gene Names: TNIP1; VAN; NAF1; ABIN-1; nip40-1
• Reactivity: Dog, Horse, Human
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: TNIP1; Polyclonal Antibody; TNIP1 antibody - C-terminal region; anti-TNIP1 antibody

• Host: Rabbit
• Reactivity: Dog, Horse, Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: NSRLFHLPEYTWRLPCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ
• Sequence Length: 636

• Applicable Applications for anti-TNIP1 antibody: Western Blot (WB)
• Homology: Dog: 92%; Horse: 86%; Human: 100%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNIP1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellTNIP1 is supported by BioGPS gene expression data to be expressed in HeLa)

Related Product Information for anti-TNIP1 antibody

This is a rabbit polyclonal antibody against TNIP1. It was validated on Western Blot

Target Description: TNIP1 interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal. TNIP1 increases cell surface CD4(T4) antigen expression. TNIP1 interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. TNIP1 may regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production.

Product Categories/Family for anti-TNIP1 antibody

Polyclonal; Apoptosis; E3 & Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 116256481
• NCBI GeneID: 10318
• NCBI Accession #: NP_006049
• NCBI GenBank Nucleotide #: NM_006058
• UniProt Accession #: Q15025
• Molecular Weight: 70kDa
• NCBI Official Full Name: TNFAIP3-interacting protein 1 isoform 3
• NCBI Official Synonym Full Names: TNFAIP3 interacting protein 1
• NCBI Official Symbol: TNIP1
• NCBI Official Synonym Symbols: VAN; NAF1; ABIN-1; nip40-1
• NCBI Protein Information: TNFAIP3-interacting protein 1
• UniProt Protein Name: TNFAIP3-interacting protein 1
• Protein Family: TNFAIP3-interacting protein
• UniProt Gene Name: TNIP1
• UniProt Synonym Gene Names: KIAA0113; NAF1; ABIN-1; Naf1; VAN; hVAN
• UniProt Entry Name: TNIP1_HUMAN

NCBI Description

This gene encodes an A20-binding protein which plays a role in autoimmunity and tissue homeostasis through the regulation of nuclear factor kappa-B activation. Mutations in this gene have been associated with psoriatic arthritis, rheumatoid arthritis, and systemic lupus erythematosus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

TNIP1: Interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal; however, binding to A20/TNFAIP3 seems not to be required for this function. Inhibits NF-kappa-B activation by regulating A20/TNFAIP3-mediated deubiquitination of IKBKG; proposed to link A20/TNFAIP3 to ubiquitinated IKBKG. Involved in regulation of EGF-induced ERK1/ERK2 signaling pathway; blocks MAPK3/MAPK1 nuclear translocation and MAPK1-dependent transcricption. Increases cell surface CD4(T4) antigen expression. Involved in the anti-inflammatory response of macrophages and positively regulates TLR-induced activation of CEBPB. Involved in the prevention of autoimmunity; this function implicates binding to polyubiquitin. Involved in leukocyte integrin activation during inflamation; this function is mediated by association with SELPLG and dependent on phosohorylation by SRC-family kinases. Interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. May regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production. In case of infection, promotes association of IKBKG with Shigella flexneri E3 ubiquitin-protein ligase ipah9.8 p which in turn promotes polyubiquitination of IKBKG leading to its proteasome-dependent degradation and thus is perturbing NF-kappa-B activation during bacterial infection. Interacts with TNFAIP3 and IKBKG; facilitates TNFAIP3- mediated de-ubiquitination of NEMO/IKBKG. Interacts with HIV-1 matrix protein. Interacts with Shigella flexneri ipah9.8; the interaction promotes polyubiquitination of IKBKG. Interacts with polyubiquitin. Interacts with MAPK1, SELPLG and PIK3CD. Interacts with IKBKG (polyubiquitinated). Interacts with IRAK1 (polyubiquitinated). Interacts with MYD88; the interaction is indicative for participation in an activated TLR-signaling complex. Ubiquitous. Strongly expressed in peripheral blood lymphocytes, spleen and skeletal muscle, and is weakly expressed in the brain. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation

Chromosomal Location of Human Ortholog: 5q32-q33.1

Cellular Component: cytoplasm; intracellular; nucleus

Molecular Function: protein binding; ubiquitin-specific protease activity; mitogen-activated protein kinase binding

Biological Process: MyD88-dependent toll-like receptor signaling pathway; leukocyte adhesion; negative regulation of viral genome replication; glycoprotein biosynthetic process; translation; defense response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of I-kappaB kinase/NF-kappaB cascade; inflammatory response; positive regulation of inflammatory response