Western Blot (WB)
(WB Suggested Anti-TMEM63B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Rabbit TMEM63B Polyclonal Antibody | anti-TMEM63B antibody
TMEM63B antibody - middle region
Gene Names
TMEM63B; C6orf110
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM63B; Polyclonal Antibody; TMEM63B antibody - middle region; anti-TMEM63B antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA
Sequence Length
832
Applicable Applications for anti-TMEM63B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TMEM63B
Protein Size (# AA)
832 amino acids
Tissue Tool
Find tissues and cell lines supported by DNA array analysis to express TMEM63B.
RNA Seq
Find tissues and cell lines supported by RNA-seq analysis to express TMEM63B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TMEM63B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-TMEM63B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Related Product Information for anti-TMEM63B antibody
This is a rabbit polyclonal antibody against TMEM63B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.
Target Description: TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.
Product Categories/Family for anti-TMEM63B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
CSC1-like protein 2
NCBI Official Synonym Full Names
transmembrane protein 63B
NCBI Official Symbol
TMEM63B
NCBI Official Synonym Symbols
C6orf110
NCBI Protein Information
CSC1-like protein 2
UniProt Protein Name
CSC1-like protein 2
Protein Family
UniProt Gene Name
TMEM63B
UniProt Synonym Gene Names
C6orf110
UniProt Entry Name
CSCL2_HUMAN
Similar Products
Product Notes
The TMEM63B tmem63b (Catalog #AAA3205540) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM63B antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM63B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEM63B tmem63b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRGCEQVEAI EYYTKLEQKL KEDYKREKEK VNEKPLGMAF VTFHNETITA. It is sometimes possible for the material contained within the vial of "TMEM63B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
