Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Rbm3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Rabbit Rbm3 Polyclonal Antibody | anti-RBM3 antibody

Rbm3 antibody - N-terminal region

Gene Names
Rbm3; 2600016C11Rik
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity :Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rbm3; Polyclonal Antibody; Rbm3 antibody - N-terminal region; anti-RBM3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity :Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNP
Sequence Length
154
Applicable Applications for anti-RBM3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Protein Size (# AA)
154 amino acids
Description of Target
The function of this protein remains unknown.
Protein Interactions
Rpl4; Rara; Hnrnpk
Blocking Peptide
For anti-Rbm3 (MBS3205137) antibody is Catalog # MBS3230102
Tissue Tool
Find tissues and cell lines supported by DNA array analysis to express Rbm3.
Protein Name
Putative RNA-binding protein 3 Ensembl ENSMUSP00000111280 Ensembl ENSMUSP00000038964 Ensembl ENSMUSP00000111279
RNA Seq
Find tissues and cell lines supported by RNA-seq analysis to express Rbm3.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Rbm3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Western Blot (WB) (WB Suggested Anti-Rbm3 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-RBM3 antibody
This is a rabbit polyclonal antibody against Rbm3. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-RBM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
RNA-binding protein 3 isoform 1
NCBI Official Synonym Full Names
RNA binding motif (RNP1, RRM) protein 3
NCBI Official Symbol
Rbm3
NCBI Official Synonym Symbols
2600016C11Rik
NCBI Protein Information
RNA-binding protein 3
Protein Family

Research Articles on RBM3

Similar Products

Product Notes

The RBM3 (Catalog #AAA3205137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rbm3 antibody - N-terminal region reacts with Tested Reactivity: Mouse Predicted Reactivity :Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Rbm3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBM3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFVGGLNFNT DEQALEDHFS SFGPISEVVV VKDRETQRSR GFGFITFTNP. It is sometimes possible for the material contained within the vial of "Rbm3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.