Western Blot (WB)
(WB Suggested Anti-TMTC2 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Rabbit TMTC2 Polyclonal Antibody | anti-TMTC2 antibody
TMTC2 antibody - N-terminal region
Gene Names
TMTC2; IBDBP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMTC2; Polyclonal Antibody; TMTC2 antibody - N-terminal region; anti-TMTC2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK
Sequence Length
836
Applicable Applications for anti-TMTC2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TMTC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TMTC2 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Western Blot (WB)
(WB Suggested Anti-TMTC2 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysate)
Related Product Information for anti-TMTC2 antibody
This is a rabbit polyclonal antibody against TMTC2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TMTC2 is a multi-pass membrane protein, which contains 10 TPR repeats.It belongs to the TMTC family. The exact function of TMTC2 remains unknown.
Target Description: TMTC2 is a multi-pass membrane protein, which contains 10 TPR repeats.It belongs to the TMTC family. The exact function of TMTC2 remains unknown.
Product Categories/Family for anti-TMTC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
protein O-mannosyl-transferase TMTC2 isoform 1
NCBI Official Synonym Full Names
transmembrane and tetratricopeptide repeat containing 2
NCBI Official Symbol
TMTC2
NCBI Official Synonym Symbols
IBDBP1
NCBI Protein Information
protein O-mannosyl-transferase TMTC2; transmembrane and TPR repeat-containing protein 2
UniProt Protein Name
Transmembrane and TPR repeat-containing protein 2
Protein Family
UniProt Gene Name
TMTC2
UniProt Entry Name
TMTC2_HUMAN
NCBI Description
The protein encoded by this gene is an integral membrane protein localized to the endoplasmic reticulum (ER). The encoded protein contains many tetratricopeptide repeats, sequences known for being involved in protein-protein interactions. This protein binds both the calcium uptake pump SERCA2B and the carbohydrate-binding chaperone calnexin, and it appears to play a role in calcium homeostasis in the ER. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
Research Articles on TMTC2
Similar Products
Product Notes
The TMTC2 tmtc2 (Catalog #AAA3209310) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMTC2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TMTC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMTC2 tmtc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SNSDNPAADS DSLLTRTLTF FYLPTKNLWL LLCPDTLSFD WSMDAVPLLK. It is sometimes possible for the material contained within the vial of "TMTC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
