Western Blot (WB)
(WB Suggested Anti-TMEM63A Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysate)
Rabbit TMEM63A Polyclonal Antibody | anti-TMEM63A antibody
TMEM63A antibody - N-terminal region
Gene Names
TMEM63A; KIAA0792
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM63A; Polyclonal Antibody; TMEM63A antibody - N-terminal region; anti-TMEM63A antibody
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP
Sequence Length
807
Applicable Applications for anti-TMEM63A antibody
Western Blot (WB)
Homology
Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%; Yeast: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM63A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TMEM63A Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysate)
Western Blot (WB)
(WB Suggested Anti-TMEM63A Antibody Titration: 0.2-1 ug/mlPositive Control: 293T cell lysate)
Related Product Information for anti-TMEM63A antibody
This is a rabbit polyclonal antibody against TMEM63A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.
Target Description: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.
Product Categories/Family for anti-TMEM63A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
CSC1-like protein 1
NCBI Official Synonym Full Names
transmembrane protein 63A
NCBI Official Symbol
TMEM63A
NCBI Official Synonym Symbols
KIAA0792
NCBI Protein Information
CSC1-like protein 1
UniProt Protein Name
CSC1-like protein 1
Protein Family
UniProt Gene Name
TMEM63A
UniProt Synonym Gene Names
KIAA0489; KIAA0792
UniProt Entry Name
CSCL1_HUMAN
Research Articles on TMEM63A
Similar Products
Product Notes
The TMEM63A tmem63a (Catalog #AAA3205469) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM63A antibody - N-terminal region reacts with Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM63A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEM63A tmem63a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDSPFLELWQ SKAVSIREQL GLGDRPNDSY CYNSAKNSTV LQGVTFGGIP. It is sometimes possible for the material contained within the vial of "TMEM63A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
