Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TGFBR2Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit TGFBR2 Polyclonal Antibody | anti-TGFBR2 antibody

TGFBR2 antibody - N-terminal region

Gene Names
TGFBR2; AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TBRII; TBR-ii; TGFR-2; TGFbeta-RII
Reactivity
Cow, Goat, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
TGFBR2; Polyclonal Antibody; TGFBR2 antibody - N-terminal region; anti-TGFBR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT
Sequence Length
567
Applicable Applications for anti-TGFBR2 antibody
Western Blot (WB)
Homology
Cow: 93%; Goat: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%; Sheep: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TGFBR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TGFBR2Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TGFBR2Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TGFBR2 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysateTGFBR2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (WB Suggested Anti-TGFBR2 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysateTGFBR2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-TGFBR2 antibody
This is a rabbit polyclonal antibody against TGFBR2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.This gene is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It encodes a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein and binds TGF-beta. This receptor/ligand complex phosphorylates proteins which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
TGF-beta receptor type-2 isoform B
NCBI Official Synonym Full Names
transforming growth factor beta receptor 2
NCBI Official Symbol
TGFBR2
NCBI Official Synonym Symbols
AAT3; FAA3; LDS2; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TBRII; TBR-ii; TGFR-2; TGFbeta-RII
NCBI Protein Information
TGF-beta receptor type-2
UniProt Protein Name
TGF-beta receptor type-2
Protein Family
UniProt Gene Name
TGFBR2
UniProt Synonym Gene Names
TGFR-2; TGF-beta receptor type II; TbetaR-II
UniProt Entry Name
TGFR2_HUMAN

NCBI Description

The protein encoded by this gene is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of genes related to cell proliferation, cell cycle arrest, wound healing, immunosuppression, and tumorigenesis. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized. [provided by RefSeq, Aug 2017]

Uniprot Description

TGFBR2: a TKL kinase of the serine/threonine-protein kinase receptor (STKR) family. R1 and R2 TGF-beta receptors dimerize after binding TGF-beta at the cell surface. Binds to DAXX. Defects can cause esophageal cancer.

Protein type: EC 2.7.11.30; Oncoprotein; Membrane protein, integral; Kinase, protein; Protein kinase, TKL; Protein kinase, Ser/Thr (receptor); TKL group; STKR family; Type2 subfamily

Chromosomal Location of Human Ortholog: 3p22

Cellular Component: plasma membrane; integral to membrane; caveola; cytosol; receptor complex; external side of plasma membrane

Molecular Function: transforming growth factor beta receptor activity; protein binding; glycosaminoglycan binding; transforming growth factor beta receptor activity, type II; transforming growth factor beta binding; metal ion binding; mitogen-activated protein kinase kinase kinase binding; SMAD binding; ATP binding; transmembrane receptor protein serine/threonine kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: lens development in camera-type eye; wound healing; apoptosis; heart development; positive regulation of smooth muscle cell proliferation; myeloid dendritic cell differentiation; gastrulation; palate development; positive regulation of tolerance induction to self antigen; protein amino acid phosphorylation; negative regulation of cardiac muscle cell proliferation; transforming growth factor beta receptor signaling pathway; positive regulation of mesenchymal cell proliferation; positive regulation of cell proliferation; response to glucose stimulus; positive regulation of NK T cell differentiation; vasculogenesis; positive regulation of T cell tolerance induction; response to nutrient; aging; response to drug; receptor-mediated endocytosis; blood vessel development; smoothened signaling pathway; organ regeneration; positive regulation of skeletal muscle regeneration; in utero embryonic development; embryonic hemopoiesis; common-partner SMAD protein phosphorylation; peptidyl-threonine phosphorylation; embryonic cranial skeleton morphogenesis; regulation of cell proliferation; patterning of blood vessels; peptidyl-serine phosphorylation; positive regulation of angiogenesis; gut development; regulation of gene expression; response to mechanical stimulus; response to estrogen stimulus; positive regulation of B cell tolerance induction; activation of protein kinase activity; brain development; negative regulation of transforming growth factor beta receptor signaling pathway; embryo implantation

Disease: Colorectal Cancer, Hereditary Nonpolyposis, Type 6; Loeys-dietz Syndrome 2; Esophageal Cancer

Research Articles on TGFBR2

Similar Products

Product Notes

The TGFBR2 tgfbr2 (Catalog #AAA3207516) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TGFBR2 antibody - N-terminal region reacts with Cow, Goat, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TGFBR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TGFBR2 tgfbr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGRGLLRGLW PLHIVLWTRI ASTIPPHVQK SDVEMEAQKD EIICPSCNRT. It is sometimes possible for the material contained within the vial of "TGFBR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.