Western Blot (WB)
(Western Blot analysis of C21orf7 expression in transfected 293T cell line by C21orf7 polyclonal antibody. Lane 1: C21orf7 transfected lysate (26.62kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human TAK1L Polyclonal Antibody | anti-MAP3K7CL antibody
TAK1L (C21orf7, TAK1-like Protein)
Gene Names
MAP3K7CL; TAKL; TAK1L; TAKL-1; TAKL-2; TAKL-4; C21orf7; HC21ORF7
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
TAK1L; Polyclonal Antibody; TAK1L (C21orf7; TAK1-like Protein); Anti -TAK1L (C21orf7; anti-MAP3K7CL antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C21orf7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVQLIAPLEVMWNEAADLKPLALSRRLECSGGIMAHYSPDLLGPEMESRYFAQVGLEHLASSSPPAFGFLKCLDYSISVLCSATSLAMLEDNPKVSKLATGDWMLTLKPKSITVPVEIPSSPLDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS
Applicable Applications for anti-MAP3K7CL antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human C21orf7, aa1-242 (NP_064537.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of C21orf7 expression in transfected 293T cell line by C21orf7 polyclonal antibody. Lane 1: C21orf7 transfected lysate (26.62kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of C21orf7 expression in transfected 293T cell line by C21orf7 polyclonal antibody. Lane 1: C21orf7 transfected lysate (26.62kD). Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to C21orf7 on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to C21orf7 on HeLa cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-MAP3K7CL antibody
Detected in lung and peripheral blood leukocytes. Expressed predominantly in peripheral blood leukocytes and ubiquitously in adult and fetal tissues. Also expressed strongly in breast carcinoma GI-101, colon adenocarcinoma GI-112, and prostatic adenocarcinoma PC3.
Product Categories/Family for anti-MAP3K7CL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
27,248 Da
NCBI Official Full Name
TAK1-like protein
NCBI Official Synonym Full Names
MAP3K7 C-terminal like
NCBI Official Symbol
MAP3K7CL
NCBI Official Synonym Symbols
TAKL; TAK1L; TAKL-1; TAKL-2; TAKL-4; C21orf7; HC21ORF7
NCBI Protein Information
MAP3K7 C-terminal-like protein; TAK1-like protein 1; TAK1-like protein 2; TAK1-like protein 4; TGF-beta activated kinase
UniProt Protein Name
MAP3K7 C-terminal-like protein
Protein Family
UniProt Gene Name
MAP3K7CL
UniProt Synonym Gene Names
C21orf7; TAK1L
UniProt Entry Name
M3KCL_HUMAN
Uniprot Description
MAP3K7CL: 4 isoforms of the human protein are produced by alternative splicing
Chromosomal Location of Human Ortholog: 21q22.3
Cellular Component: cytosol; nucleus
Molecular Function: protein binding
Similar Products
Product Notes
The MAP3K7CL map3k7cl (Catalog #AAA6007292) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAK1L (C21orf7, TAK1-like Protein) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAK1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the MAP3K7CL map3k7cl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVQLIAPLEV MWNEAADLKP LALSRRLECS GGIMAHYSPD LLGPEMESRY FAQVGLEHLA SSSPPAFGFL KCLDYSISVL CSATSLAMLE DNPKVSKLAT GDWMLTLKPK SITVPVEIPS SPLDDTPPED SIPLVFPELD QQLQPLPPCH DSEESMEVFK QHCQIAEEYH EVKKEITLLE QRKKELIAKL DQAEKEKVDA AELVREFEAL TEENRTLRLA QSQCVEQLEK LRIQYQKRQG SS. It is sometimes possible for the material contained within the vial of "TAK1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
