Western Blot (WB)
(Host: RabbitTarget Name: SYCE1LSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse SYCE1L Polyclonal Antibody | anti-SYCE1L antibody
SYCE1L Antibody - middle region
Gene Names
Syce1l; MMRP; PSESS; mmrp2; 4930481F22Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
SYCE1L; Polyclonal Antibody; SYCE1L Antibody - middle region; anti-SYCE1L antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAEDTRGQAASLNTMEDLLETVKKLQKEGSLEPQIEDLIHRINELQQGPA
Sequence Length
247
Applicable Applications for anti-SYCE1L antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse SYCE1L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SYCE1LSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SYCE1LSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SYCE1L antibody
May be involved in meiosis. Isoform 1 may be involved in meiosis during spermatogenesis while isoform 2 is probably related to a later stage of meiosis, in the development stage of secondary spermatocytes and spermatids.
Product Categories/Family for anti-SYCE1L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28 kDa
NCBI Official Full Name
synaptonemal complex central element protein 1-like isoform 1
NCBI Official Synonym Full Names
synaptonemal complex central element protein 1 like
NCBI Official Symbol
Syce1l
NCBI Official Synonym Symbols
MMRP; PSESS; mmrp2; 4930481F22Rik
NCBI Protein Information
synaptonemal complex central element protein 1-like
UniProt Protein Name
Synaptonemal complex central element protein 1-like
Protein Family
UniProt Gene Name
Syce1l
UniProt Synonym Gene Names
Mmrp2
Uniprot Description
May be involved in meiosis. Isoform 1 may be involved in meiosis during spermatogenesis while isoform 2 is probably related to a later stage of meiosis, in the development stage of secondary spermatocytes and spermatids.
Research Articles on SYCE1L
Similar Products
Product Notes
The SYCE1L syce1l (Catalog #AAA3223985) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYCE1L Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SYCE1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYCE1L syce1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAEDTRGQAA SLNTMEDLLE TVKKLQKEGS LEPQIEDLIH RINELQQGPA. It is sometimes possible for the material contained within the vial of "SYCE1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
