Western Blot (WB)
(Host: RabbitTarget Name: NUP62Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse NUP62 Polyclonal Antibody | anti-NUP62 antibody
NUP62 Antibody - middle region
Gene Names
Nup62; p62; Nupc1; D7Ertd649e
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
NUP62; Polyclonal Antibody; NUP62 Antibody - middle region; anti-NUP62 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FILSQQKELEDLLSPLEESVKEQSGTIYLQHADEEREKTYKLAENIDAQL
Sequence Length
526
Applicable Applications for anti-NUP62 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse NUP62
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NUP62Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NUP62Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NUP62 antibody
Essential component of the nuclear pore complex. The N-terminal is probably involved in nucleocytoplasmic transport. The C-terminal is involved in protein-protein interaction probably via coiled-coil formation, promotes its association with centrosomes and may function in anchorage of p62 to the pore complex. Plays a role in mitotic cell cycle progression by regulating centrosome segregation, centriole maturation and spindle orientation. It might be involved in protein recruitment to the centrosome after nuclear breakdown.
Product Categories/Family for anti-NUP62 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
nuclear pore glycoprotein p62
NCBI Official Synonym Full Names
nucleoporin 62
NCBI Official Symbol
Nup62
NCBI Official Synonym Symbols
p62; Nupc1; D7Ertd649e
NCBI Protein Information
nuclear pore glycoprotein p62
UniProt Protein Name
Nuclear pore glycoprotein p62
Protein Family
UniProt Gene Name
Nup62
UniProt Entry Name
NUP62_MOUSE
Research Articles on NUP62
Similar Products
Product Notes
The NUP62 nup62 (Catalog #AAA3223696) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUP62 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NUP62 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUP62 nup62 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FILSQQKELE DLLSPLEESV KEQSGTIYLQ HADEEREKTY KLAENIDAQL. It is sometimes possible for the material contained within the vial of "NUP62, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
