Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DYRK2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DYRK2 Polyclonal Antibody | anti-DYRK2 antibody

DYRK2 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DYRK2; Polyclonal Antibody; DYRK2 Antibody - middle region; anti-DYRK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHD
Sequence Length
601
Applicable Applications for anti-DYRK2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DYRK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DYRK2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DYRK2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DYRK2 antibody
DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro. Two isoforms of DYRK2 have been isolated. The predominant isoform, isoform 1, lacks a 5' terminal insert.
Product Categories/Family for anti-DYRK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66 kDa
NCBI Official Full Name
dual specificity tyrosine-phosphorylation-regulated kinase 2 isoform 1
NCBI Official Synonym Full Names
dual specificity tyrosine phosphorylation regulated kinase 2
NCBI Official Symbol
DYRK2
NCBI Protein Information
dual specificity tyrosine-phosphorylation-regulated kinase 2
UniProt Protein Name
Dual specificity tyrosine-phosphorylation-regulated kinase 2
UniProt Gene Name
DYRK2
UniProt Entry Name
DYRK2_HUMAN

NCBI Description

DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro. Two isoforms of DYRK2 have been isolated. The predominant isoform, isoform 1, lacks a 5' terminal insert. [provided by RefSeq, Jul 2008]

Uniprot Description

DYRK2: a dual-specificity protein kinase of the DYRK family. Localizes in the cytoplasm. Phosphorylates the translation initiation factor eIF2B at Ser539, priming it for phosphorylation by glycogen synthase kinase-3.

Protein type: Protein kinase, CMGC; Kinase, protein; Protein kinase, dual-specificity (non-receptor); EC 2.7.12.1; CMGC group; DYRK family; Dyrk2 subfamily

Chromosomal Location of Human Ortholog: 12q15

Cellular Component: nucleoplasm; cytoplasm; nucleus; ribonucleoprotein complex; ubiquitin ligase complex

Molecular Function: protein serine/threonine kinase activity; protein binding; ubiquitin binding; protein-tyrosine kinase activity; manganese ion binding; protein serine/threonine/tyrosine kinase activity; magnesium ion binding; ATP binding

Biological Process: smoothened signaling pathway; peptidyl-tyrosine phosphorylation; positive regulation of glycogen biosynthetic process; negative regulation of NFAT protein import into nucleus; protein amino acid phosphorylation; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; response to DNA damage stimulus

Research Articles on DYRK2

Similar Products

Product Notes

The DYRK2 dyrk2 (Catalog #AAA3223482) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DYRK2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DYRK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DYRK2 dyrk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTAFEHHEIF SYPEIYFLGL NAKKRQGMTG GPNNGGYDDD QGSYVQVPHD. It is sometimes possible for the material contained within the vial of "DYRK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.