Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TOR1AIP1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TOR1AIP1 Polyclonal Antibody | anti-TOR1AIP1 antibody

TOR1AIP1 Antibody - C-terminal region

Gene Names
TOR1AIP1; LAP1; LAP1B; LGMD2Y
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TOR1AIP1; Polyclonal Antibody; TOR1AIP1 Antibody - C-terminal region; anti-TOR1AIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHL
Sequence Length
379
Applicable Applications for anti-TOR1AIP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TOR1AIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TOR1AIP1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TOR1AIP1Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TOR1AIP1 antibody
This gene encodes a type 2 integral membrane protein that binds A- and B-type laminins. The encoded protein localizes to the inner nuclear membrane and may be involved in maintaining the attachment of the nuclear membrane to the nuclear lamina during cell division. Alternate splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
torsin-1A-interacting protein 1 isoform 2
NCBI Official Synonym Full Names
torsin 1A interacting protein 1
NCBI Official Symbol
TOR1AIP1
NCBI Official Synonym Symbols
LAP1; LAP1B; LGMD2Y
NCBI Protein Information
torsin-1A-interacting protein 1
UniProt Protein Name
Torsin-1A-interacting protein 1
UniProt Gene Name
TOR1AIP1
UniProt Synonym Gene Names
LAP1B
UniProt Entry Name
TOIP1_HUMAN

NCBI Description

This gene encodes a type 2 integral membrane protein that binds A- and B-type lamins. The encoded protein localizes to the inner nuclear membrane and may be involved in maintaining the attachment of the nuclear membrane to the nuclear lamina during cell division. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2016]

Uniprot Description

TOR1AIP1: Binds to A- and B-type lamins. Possible role in membrane attachment and assembly of the nuclear lamina. Belongs to the TOR1AIP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: integral to membrane; nuclear inner membrane; nucleus

Molecular Function: ATPase activator activity; cytoskeletal protein binding; ATPase binding; lamin binding

Biological Process: positive regulation of ATPase activity

Research Articles on TOR1AIP1

Similar Products

Product Notes

The TOR1AIP1 tor1aip1 (Catalog #AAA3220044) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TOR1AIP1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TOR1AIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOR1AIP1 tor1aip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLGTSLGLKE VEEKVRDFLK VKFTNSNTPN SYNHMDPDKL NGLWSRISHL. It is sometimes possible for the material contained within the vial of "TOR1AIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.