Western Blot (WB)
(Western Blot analysis of SUSD4 expression in transfected 293T cell line by SUSD4 polyclonal antibody. Lane 1: SUSD4 transfected lysate (31.9kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human SUSD4 Polyclonal Antibody | anti-SUSD4 antibody
SUSD4 (Sushi Domain-containing Protein 4, UNQ196/PRO222, RP11-239E10.4)
Gene Names
SUSD4; PRO222; RP11-239E10.4
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SUSD4; Polyclonal Antibody; SUSD4 (Sushi Domain-containing Protein 4; UNQ196/PRO222; RP11-239E10.4); Anti -SUSD4 (Sushi Domain-containing Protein 4; anti-SUSD4 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SUSD4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTCSSTSTTTSLF
Applicable Applications for anti-SUSD4 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SUSD4, aa1-290 (NP_001032252.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of SUSD4 expression in transfected 293T cell line by SUSD4 polyclonal antibody. Lane 1: SUSD4 transfected lysate (31.9kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SUSD4 expression in transfected 293T cell line by SUSD4 polyclonal antibody. Lane 1: SUSD4 transfected lysate (31.9kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SUSD4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,778 Da
NCBI Official Full Name
sushi domain-containing protein 4 isoform a
NCBI Official Synonym Full Names
sushi domain containing 4
NCBI Official Symbol
SUSD4
NCBI Official Synonym Symbols
PRO222; RP11-239E10.4
NCBI Protein Information
sushi domain-containing protein 4; YHGM196
UniProt Protein Name
Sushi domain-containing protein 4
Protein Family
UniProt Gene Name
SUSD4
UniProt Entry Name
SUSD4_HUMAN
Uniprot Description
SUSD4: 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 1q41
Cellular Component: integral to membrane
Biological Process: negative regulation of complement activation, alternative pathway; negative regulation of complement activation, classical pathway; regulation of complement activation
Research Articles on SUSD4
Similar Products
Product Notes
The SUSD4 susd4 (Catalog #AAA6009066) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SUSD4 (Sushi Domain-containing Protein 4, UNQ196/PRO222, RP11-239E10.4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SUSD4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SUSD4 susd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYHGMNPSNG DGFLEQQQQQ QQPQSPQRLL AVILWFQLAL CFGPAQLTGG FDDLQVCADP GIPENGFRTP SGGVFFEGSV ARFHCQDGFK LKGATKRLCL KHFNGTLGWI PSDNSICVQE DCRIPQIEDA EIHNKTYRHG EKLIITCHEG FKIRYPDLHN MVSLCRDDGT WNNLPICQGC LRPLASSNGY VNISELQTSF PVGTVISYRC FPGFKLDGSA YLECLQNLIW SSSPPRCLAL EGGRPEHLFP VLYFPHIRLA AAVLYFCPVL KSSPTPAPTC SSTSTTTSLF. It is sometimes possible for the material contained within the vial of "SUSD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
