Western Blot (WB)
(SUSD4 antibody (MBS5300645) used at 1 ug/ml to detect target protein.)
Rabbit SUSD4 Polyclonal Antibody | anti-SUSD4 antibody
SUSD4 antibody
Gene Names
SUSD4; PRO222
Applications
Western Blot
Purity
Affinity purified
Synonyms
SUSD4; Polyclonal Antibody; SUSD4 antibody; Polyclonal SUSD4; Anti-SUSD4; SUSD 4; Sushi Domain Containing 4; SUSD-4; FLJ10052; PRO222; anti-SUSD4 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
SUSD4 antibody was raised against the N terminal of SUSD4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SUSD4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
490
Applicable Applications for anti-SUSD4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.
Cross-Reactivity
Human
Immunogen
SUSD4 antibody was raised using the N terminal of SUSD4 corresponding to a region with amino acids MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(SUSD4 antibody (MBS5300645) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(SUSD4 antibody (MBS5300645) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SUSD4 antibody
Rabbit polyclonal SUSD4 antibody raised against the N terminal of SUSD4
Product Categories/Family for anti-SUSD4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32 kDa (MW of target protein)
NCBI Official Full Name
sushi domain-containing protein 4 isoform a
NCBI Official Synonym Full Names
sushi domain containing 4
NCBI Official Symbol
SUSD4
NCBI Official Synonym Symbols
PRO222
NCBI Protein Information
sushi domain-containing protein 4
UniProt Protein Name
Sushi domain-containing protein 4
Protein Family
UniProt Gene Name
SUSD4
UniProt Entry Name
SUSD4_HUMAN
Uniprot Description
SUSD4: 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 1q41
Cellular Component: integral to membrane
Biological Process: negative regulation of complement activation, alternative pathway; negative regulation of complement activation, classical pathway; regulation of complement activation
Research Articles on SUSD4
Similar Products
Product Notes
The SUSD4 susd4 (Catalog #AAA5300645) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SUSD4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SUSD4 susd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SUSD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
