Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AKAP8Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human AKAP8 Polyclonal Antibody | anti-AKAP8 antibody

AKAP8 Antibody - middle region

Gene Names
AKAP8; AKAP-8; AKAP95; AKAP 95; AKAP-95
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
AKAP8; Polyclonal Antibody; AKAP8 Antibody - middle region; anti-AKAP8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VMGMQGAGGYDSTMPYGCGRSQPRMRDRDRPKRRGFDRFGPDGTGRKRKQ
Sequence Length
692
Applicable Applications for anti-AKAP8 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AKAP8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AKAP8Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AKAP8Sample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-AKAP8 antibody
This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins are scaffold proteins that contain a binding domain for the RI/RII subunit of protein kinase A (PKA) and recruit PKA and other signaling molecules to specific subcellular locations. This gene encodes a nuclear A-kinase anchor protein that binds to the RII alpha subunit of PKA and may play a role in chromosome condensation during mitosis by targeting PKA and the condensin complex to chromatin. A pseudogene of this gene is located on the short arm of chromosome 9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76 kDa
NCBI Official Full Name
A-kinase anchor protein 8
NCBI Official Synonym Full Names
A-kinase anchoring protein 8
NCBI Official Symbol
AKAP8
NCBI Official Synonym Symbols
AKAP-8; AKAP95; AKAP 95; AKAP-95
NCBI Protein Information
A-kinase anchor protein 8
UniProt Protein Name
A-kinase anchor protein 8
Protein Family
UniProt Gene Name
AKAP8
UniProt Synonym Gene Names
AKAP95; AKAP-8; AKAP 95
UniProt Entry Name
AKAP8_HUMAN

NCBI Description

This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins are scaffold proteins that contain a binding domain for the RI/RII subunit of protein kinase A (PKA) and recruit PKA and other signaling molecules to specific subcellular locations. This gene encodes a nuclear A-kinase anchor protein that binds to the RII alpha subunit of PKA and may play a role in chromosome condensation during mitosis by targeting PKA and the condensin complex to chromatin. A pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, May 2011]

Uniprot Description

AKAP8: Anchoring protein that mediates the subcellular compartmentation of cAMP-dependent protein kinase (PKA type II). Belongs to the AKAP95 family.

Protein type: Mitochondrial; Cell cycle regulation; RNA-binding; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: nucleoplasm; Golgi apparatus; nuclear matrix; mitochondrion; membrane; condensed chromosome; female pronucleus; nucleus

Molecular Function: zinc ion binding; double-stranded DNA binding

Biological Process: mitosis; mitotic chromosome condensation; signal transduction

Research Articles on AKAP8

Similar Products

Product Notes

The AKAP8 akap8 (Catalog #AAA3223522) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKAP8 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AKAP8 akap8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VMGMQGAGGY DSTMPYGCGR SQPRMRDRDR PKRRGFDRFG PDGTGRKRKQ. It is sometimes possible for the material contained within the vial of "AKAP8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.