Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STEAP2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit STEAP2 Polyclonal Antibody | anti-STEAP2 antibody

STEAP2 Antibody - middle region

Gene Names
STEAP2; STMP; IPCA1; PUMPCn; STAMP1; PCANAP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STEAP2; Polyclonal Antibody; STEAP2 Antibody - middle region; anti-STEAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNM
Sequence Length
419
Applicable Applications for anti-STEAP2 antibody
Western Blot (WB)
Homology
Cow: 91%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human STEAP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STEAP2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STEAP2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-STEAP2 antibody
This is a rabbit polyclonal antibody against STEAP2. It was validated on Western Blot

Target Description: This gene is a member of the STEAP family and encodes a multi-pass membrane protein that localizes to the Golgi complex, the plasma membrane, and the vesicular tubular structures in the cytosol. A highly similar protein in mouse has both ferrireductase and cupric reductase activity, and stimulates the cellular uptake of both iron and copper in vitro. Increased transcriptional expression of the human gene is associated with prostate cancer progression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-STEAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
metalloreductase STEAP2 isoform a
NCBI Official Synonym Full Names
STEAP2 metalloreductase
NCBI Official Symbol
STEAP2
NCBI Official Synonym Symbols
STMP; IPCA1; PUMPCn; STAMP1; PCANAP1
NCBI Protein Information
metalloreductase STEAP2
UniProt Protein Name
Metalloreductase STEAP2
Protein Family
UniProt Gene Name
STEAP2
UniProt Synonym Gene Names
PCANAP1; STAMP1; PUMPCn
UniProt Entry Name
STEA2_HUMAN

NCBI Description

This gene is a member of the STEAP family and encodes a multi-pass membrane protein that localizes to the Golgi complex, the plasma membrane, and the vesicular tubular structures in the cytosol. A highly similar protein in mouse has both ferrireductase and cupric reductase activity, and stimulates the cellular uptake of both iron and copper in vitro. Increased transcriptional expression of the human gene is associated with prostate cancer progression. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

STEAP2: Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor. Belongs to the STEAP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; EC 1.16.1.-; Membrane protein, integral; Vesicle; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7q21.13

Cellular Component: trans-Golgi network transport vesicle; intracellular membrane-bound organelle; early endosome; plasma membrane; integral to Golgi membrane; endosome membrane; cytosol

Molecular Function: transporter activity; metal ion binding; cupric reductase activity

Biological Process: regulated secretory pathway; Golgi to plasma membrane transport; iron ion homeostasis; response to hormone stimulus; copper ion import; endocytosis

Research Articles on STEAP2

Similar Products

Product Notes

The STEAP2 steap2 (Catalog #AAA3203279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STEAP2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STEAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STEAP2 steap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHVVDVTHHE DALTKTNIIF VAIHREHYTS LWDLRHLLVG KILIDVSNNM. It is sometimes possible for the material contained within the vial of "STEAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.