Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of STARD5 expression in transfected 293T cell line by STARD5 polyclonal antibody. Lane 1: STARD5 transfected lysate (23.8kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human STARD5 Polyclonal Antibody | anti-STARD5 antibody

STARD5 (StAR-Related Lipid Transfer (START) Domain Containing 5, MGC10327)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
STARD5; Polyclonal Antibody; STARD5 (StAR-Related Lipid Transfer (START) Domain Containing 5; MGC10327); Anti -STARD5 (StAR-Related Lipid Transfer (START) Domain Containing 5; anti-STARD5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human STARD5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE
Applicable Applications for anti-STARD5 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human STARD5, aa1-213 (NP_871629.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of STARD5 expression in transfected 293T cell line by STARD5 polyclonal antibody. Lane 1: STARD5 transfected lysate (23.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of STARD5 expression in transfected 293T cell line by STARD5 polyclonal antibody. Lane 1: STARD5 transfected lysate (23.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-STARD5 antibody
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD5 (Soccio et al., 2002 [PubMed 12011452]).
Product Categories/Family for anti-STARD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,794 Da
NCBI Official Full Name
stAR-related lipid transfer protein 5
NCBI Official Synonym Full Names
StAR-related lipid transfer (START) domain containing 5
NCBI Official Symbol
STARD5
NCBI Protein Information
stAR-related lipid transfer protein 5; START domain containing 5; START domain-containing protein 5
UniProt Protein Name
StAR-related lipid transfer protein 5
UniProt Gene Name
STARD5
UniProt Synonym Gene Names
StARD5
UniProt Entry Name
STAR5_HUMAN

NCBI Description

Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD5 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008]

Uniprot Description

STARD5: May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 15q26

Cellular Component: cytosol

Molecular Function: bile acid binding

Biological Process: steroid metabolic process; C21-steroid hormone biosynthetic process; lipid transport

Research Articles on STARD5

Similar Products

Product Notes

The STARD5 stard5 (Catalog #AAA6008411) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STARD5 (StAR-Related Lipid Transfer (START) Domain Containing 5, MGC10327) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STARD5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the STARD5 stard5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDPALAAQMS EAVAEKMLQY RRDTAGWKIC REGNGVSVSW RPSVEFPGNL YRGEGIVYGT LEEVWDCVKP AVGGLRVKWD ENVTGFEIIQ SITDTLCVSR TSTPSAAMKL ISPRDFVDLV LVKRYEDGTI SSNATHVEHP LCPPKPGFVR GFNHPCGCFC EPLPGEPTKT NLVTFFHTDL SGYLPQNVVD SFFPRSMTRF YANLQKAVKQ FHE. It is sometimes possible for the material contained within the vial of "STARD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.