Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: SMC3Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Rabbit SMC3 Polyclonal Antibody | anti-SMC3 antibody

SMC3 antibody - N-terminal region

Gene Names
SMC3; BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SMC3; Polyclonal Antibody; SMC3 antibody - N-terminal region; anti-SMC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDAR
Sequence Length
1217
Applicable Applications for anti-SMC3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SMC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: SMC3Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: SMC3Sample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-SMC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateThere is BioGPS gene expression data showing that SMC3 is expressed in COLO205)

Western Blot (WB) (WB Suggested Anti-SMC3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysateThere is BioGPS gene expression data showing that SMC3 is expressed in COLO205)
Related Product Information for anti-SMC3 antibody
This is a rabbit polyclonal antibody against SMC3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SMC3 belongs to the SMC3 subfamily of SMC proteins. SMC3 occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141kDa
NCBI Official Full Name
structural maintenance of chromosomes protein 3
NCBI Official Synonym Full Names
structural maintenance of chromosomes 3
NCBI Official Symbol
SMC3
NCBI Official Synonym Symbols
BAM; BMH; HCAP; CDLS3; CSPG6; SMC3L1
NCBI Protein Information
structural maintenance of chromosomes protein 3
UniProt Protein Name
Structural maintenance of chromosomes protein 3
UniProt Gene Name
SMC3
UniProt Synonym Gene Names
BAM; BMH; CSPG6; SMC3L1; SMC protein 3; SMC-3; Bamacan; hCAP
UniProt Entry Name
SMC3_HUMAN

NCBI Description

This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein. [provided by RefSeq, Jul 2008]

Uniprot Description

SMC3: Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement. Interacts with MXI1, MXD3 and MXD4. Interacts with SYCP2. Found in a complex with SMC1A, CDCA5 and RAD21, PDS5A/APRIN and PDS5B/SCC-112. Forms a heterodimer with SMC1A or SMC1B in cohesin complexes. Cohesin complexes are composed of the SMC1 (SMC1A or SMC1B) and SMC3 heterodimer attached via their hinge domain, RAD21 which link them, and one STAG protein (STAG1, STAG2 or STAG3), which interacts with RAD21. Also found in meiosis-specific cohesin complexes. Interacts with NUMA1, and forms a ternary complex with KIF3B and KIFAP3, suggesting a function in tethering the chromosomes to the spindle pole and in chromosome movement. Interacts with PDS5A and WAPAL; regulated by SMC3 acetylation. Belongs to the SMC family. SMC3 subfamily.

Protein type: Cell cycle regulation; DNA repair, damage

Chromosomal Location of Human Ortholog: 10q25

Cellular Component: cohesin complex; spindle pole; nuclear matrix; cohesin core heterodimer; chromosome; cytosol; nucleoplasm; lateral element; cytoplasm; basement membrane; chromatin; nucleus; chromosome, pericentric region

Molecular Function: dynein binding; protein binding; protein heterodimerization activity; microtubule motor activity; chromatin binding; ATP binding

Biological Process: mitosis; meiosis; mitotic spindle organization and biogenesis; cell division; mitotic sister chromatid cohesion; stem cell maintenance; sister chromatid cohesion; negative regulation of DNA endoreduplication; mitotic cell cycle; signal transduction; DNA repair; regulation of DNA replication

Disease: Cornelia De Lange Syndrome 3

Research Articles on SMC3

Similar Products

Product Notes

The SMC3 smc3 (Catalog #AAA3208651) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMC3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SMC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMC3 smc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KWDKMRRALE YTIYNQELNE TRAKLDELSA KRETSGEKSR QLRDAQQDAR. It is sometimes possible for the material contained within the vial of "SMC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.