Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC9A7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

Rabbit SLC9A7 Polyclonal Antibody | anti-SLC9A7 antibody

SLC9A7 antibody - N-terminal region

Gene Names
SLC9A7; NHE7; NHE-7; SLC9A6
Reactivity
Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC9A7; Polyclonal Antibody; SLC9A7 antibody - N-terminal region; anti-SLC9A7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI
Sequence Length
725
Applicable Applications for anti-SLC9A7 antibody
Western Blot (WB)
Homology
Dog: 100%; Goat: 85%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC9A7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC9A7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC9A7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)
Related Product Information for anti-SLC9A7 antibody
This is a rabbit polyclonal antibody against SLC9A7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.
Product Categories/Family for anti-SLC9A7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
sodium/hydrogen exchanger 7 isoform 2
NCBI Official Synonym Full Names
solute carrier family 9 member A7
NCBI Official Symbol
SLC9A7
NCBI Official Synonym Symbols
NHE7; NHE-7; SLC9A6
NCBI Protein Information
sodium/hydrogen exchanger 7
UniProt Protein Name
Sodium/hydrogen exchanger 7
UniProt Gene Name
SLC9A7
UniProt Synonym Gene Names
NHE7; NHE-7
UniProt Entry Name
SL9A7_HUMAN

NCBI Description

This gene encodes a sodium and potassium/ proton antiporter that is a member of the solute carrier family 9 protein family. The encoded protein is primarily localized to the trans-Golgi network and is involved in maintaining pH homeostasis in organelles along the secretory and endocytic pathways. This protein may enhance cell growth of certain breast tumors. This gene is part of a gene cluster on chromosome Xp11.23. A pseudogene of this gene is found on chromosome 12. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012]

Uniprot Description

NHE7: Mediates electroneutral exchange of protons for Na(+) and K(+) across endomembranes. May contribute to Golgi volume and cation homeostasis. Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family.

Protein type: Transporter, SLC family; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: Xp11.3|Xp11.3

Cellular Component: Golgi membrane; recycling endosome membrane; integral to membrane; trans-Golgi network

Molecular Function: protein binding; protein homodimerization activity; potassium:hydrogen antiporter activity; sodium:hydrogen antiporter activity

Biological Process: regulation of pH; ion transport; transmembrane transport

Research Articles on SLC9A7

Similar Products

Product Notes

The SLC9A7 slc9a7 (Catalog #AAA3207189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC9A7 antibody - N-terminal region reacts with Dog, Goat, Guinea Pig, Human, Mouse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC9A7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC9A7 slc9a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGWGLRVAAA ASASSSGAAA EDSSAMEELA TEKEAEESHR QDSVSLLTFI. It is sometimes possible for the material contained within the vial of "SLC9A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.