Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC9A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateSLC9A1 is supported by BioGPS gene expression data to be expressed in PANC1)

Rabbit SLC9A1 Polyclonal Antibody | anti-SLC9A1 antibody

SLC9A1 antibody - middle region

Gene Names
SLC9A1; APNH; NHE1; LIKNS; NHE-1; PPP1R143
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC9A1; Polyclonal Antibody; SLC9A1 antibody - middle region; anti-SLC9A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG
Sequence Length
815
Applicable Applications for anti-SLC9A1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC9A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC9A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateSLC9A1 is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB) (WB Suggested Anti-SLC9A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysateSLC9A1 is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-SLC9A1 antibody
This is a rabbit polyclonal antibody against SLC9A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The Na+/H+ antiporter (SLC9A1) is a ubiquitous membrane-bound enzyme involved in pH regulation of vertebrate cells. It is specifically inhibited by the diuretic drug amiloride and activated by a variety of signals including growth factors, mitogens, neuro

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
sodium/hydrogen exchanger 1
NCBI Official Synonym Full Names
solute carrier family 9 member A1
NCBI Official Symbol
SLC9A1
NCBI Official Synonym Symbols
APNH; NHE1; LIKNS; NHE-1; PPP1R143
NCBI Protein Information
sodium/hydrogen exchanger 1
UniProt Protein Name
Sodium/hydrogen exchanger 1
Protein Family
UniProt Gene Name
SLC9A1
UniProt Synonym Gene Names
APNH1; NHE1; NHE-1
UniProt Entry Name
SL9A1_HUMAN

NCBI Description

This gene encodes a Na+/H+ antiporter that is a member of the solute carrier family 9. The encoded protein is a plasma membrane transporter that is expressed in the kidney and intestine. This protein plays a central role in regulating pH homeostasis, cell migration and cell volume. This protein may also be involved in tumor growth. [provided by RefSeq, Sep 2011]

Uniprot Description

NHE1: sodium/hydrogen exchanger 1. Belongs to the Na(+)/H(+) exchanger family. Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient.

Protein type: Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral; Motility/polarity/chemotaxis; Transporter

Chromosomal Location of Human Ortholog: 1p36.1-p35

Cellular Component: endoplasmic reticulum membrane; focal adhesion; cell surface; mitochondrion; basolateral plasma membrane; endoplasmic reticulum; integral to plasma membrane; T-tubule; integral to membrane; lipid raft; nucleoplasm; perinuclear region of cytoplasm; lamellipodium; apical plasma membrane; cytoplasm; plasma membrane

Molecular Function: protein binding, bridging; calmodulin binding; protein binding; phosphatidylinositol-4,5-bisphosphate binding; protein complex scaffold; solute:hydrogen antiporter activity; calcium-dependent protein binding; sodium:hydrogen antiporter activity; protein phosphatase 2B binding

Biological Process: positive regulation of NFAT protein import into nucleus; glycosaminoglycan metabolic process; pathogenesis; cardiac muscle cell differentiation; hyaluronan catabolic process; regulation of pH; positive regulation of action potential; cell growth; transmembrane transport; response to drug; cellular sodium ion homeostasis; cell migration; maintenance of cell polarity; positive regulation of cell growth; protein oligomerization; cellular response to insulin stimulus; regulation of stress fiber formation; carbohydrate metabolic process; regulation of focal adhesion formation; regulation of intracellular pH; ion transport; positive regulation of transcription from RNA polymerase II promoter; response to acidity; regulation of sensory perception of pain; hyaluronan metabolic process; negative regulation of apoptosis

Disease: Lichtenstein-knorr Syndrome

Research Articles on SLC9A1

Similar Products

Product Notes

The SLC9A1 slc9a1 (Catalog #AAA3207059) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC9A1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC9A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC9A1 slc9a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSKETSSPGT DDVFTPAPSD SPSSQRIQRC LSDPGPHPEP GEGEPFFPKG. It is sometimes possible for the material contained within the vial of "SLC9A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.