Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC9A4Sample Tissue: Rat Lung lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Rat SLC9A4 Polyclonal Antibody | anti-SLC9A4 antibody

SLC9A4 Antibody - middle region

Gene Names
Slc9a4; Nhe4
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC9A4; Polyclonal Antibody; SLC9A4 Antibody - middle region; anti-SLC9A4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NMYQVRQRTLSYNKYNLKPQTSEKQAKEILIRRQNTLRESLRKGQSLPWVK
Sequence Length
717
Applicable Applications for anti-SLC9A4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of rat SLC9A4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC9A4Sample Tissue: Rat Lung lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC9A4Sample Tissue: Rat Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SLC9A4 antibody
Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction. May play a specialized role in the kidney in rectifying cell volume in response to extreme fluctuations of hyperosmolar-stimulated cell shrinkage. Is relatively amiloride and ethylisopropylamiloride (EIPA) insensitive. Can be activated under conditions of hyperosmolar-induced cell shrinkage in a sustained intracellular acidification-dependence manner. Activated by 4,4'-diisothiocyanostilbene-2,2'-disulfonic acid (DIDS) in a sustained intracellular acidification-dependence manner. Affects potassium/proton exchange as well as sodium/proton and lithium/proton exchange. In basolateral cell membrane, participates in homeostatic control of intracellular pH, and may play a role in proton extrusion in order to achieve transepithelial HCO3- secretion. In apical cell membrane may be involved in mediating sodium absorption. Requires for normal levels of gastric acid secretion, secretory membrane development, parietal cell maturation and/or differentiation and at least secondarily for chief cell differentiation.
Product Categories/Family for anti-SLC9A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82 kDa
NCBI Official Full Name
sodium/hydrogen exchanger 4
NCBI Official Synonym Full Names
solute carrier family 9 member A4
NCBI Official Symbol
Slc9a4
NCBI Official Synonym Symbols
Nhe4
NCBI Protein Information
sodium/hydrogen exchanger 4
UniProt Protein Name
Sodium/hydrogen exchanger 4
UniProt Gene Name
Slc9a4
UniProt Synonym Gene Names
Nhe4; NHE-4
UniProt Entry Name
SL9A4_RAT

Research Articles on SLC9A4

Similar Products

Product Notes

The SLC9A4 slc9a4 (Catalog #AAA3223806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC9A4 Antibody - middle region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC9A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC9A4 slc9a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NMYQVRQRTL SYNKYNLKPQ TSEKQAKEIL IRRQNTLRES LRKGQSLPWV K. It is sometimes possible for the material contained within the vial of "SLC9A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.