Western Blot (WB)
(Host: RabbitTarget Name: SLC9A3Sample Tissue: Human RPMI-8226Antibody Dilution: 1.0ug/ml)
Rabbit SLC9A3 Polyclonal Antibody | anti-SLC9A3 antibody
SLC9A3 antibody - middle region
Gene Names
SLC9A3; NHE3; DIAR8; NHE-3
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC9A3; Polyclonal Antibody; SLC9A3 antibody - middle region; anti-SLC9A3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKR
Sequence Length
834
Applicable Applications for anti-SLC9A3 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 92%; Human: 100%; Mouse: 92%; Pig: 77%; Rabbit: 77%; Rat: 92%; Sheep: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC9A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SLC9A3Sample Tissue: Human RPMI-8226Antibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SLC9A3Sample Tissue: Human RPMI-8226Antibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-SLC9A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SLC9A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)
Related Product Information for anti-SLC9A3 antibody
This is a rabbit polyclonal antibody against SLC9A3. It was validated on Western Blot
Target Description: SLC9A3 is involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. SLC9A3 is the major proton extruding system driven by the inward sodium ion chemical gradient. SLC9A3 plays an important role in signal transduction.
Target Description: SLC9A3 is involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. SLC9A3 is the major proton extruding system driven by the inward sodium ion chemical gradient. SLC9A3 plays an important role in signal transduction.
Product Categories/Family for anti-SLC9A3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
sodium/hydrogen exchanger 3 isoform 1
NCBI Official Synonym Full Names
solute carrier family 9 member A3
NCBI Official Symbol
SLC9A3
NCBI Official Synonym Symbols
NHE3; DIAR8; NHE-3
NCBI Protein Information
sodium/hydrogen exchanger 3
UniProt Protein Name
Sodium/hydrogen exchanger 3
Protein Family
UniProt Gene Name
SLC9A3
UniProt Synonym Gene Names
NHE-3
NCBI Description
The protein encoded by this gene is an epithelial brush border Na/H exchanger that uses an inward sodium ion gradient to expel acids from the cell. Defects in this gene are a cause of congenital secretory sodium diarrhea. Pseudogenes of this gene exist on chromosomes 10 and 22. [provided by RefSeq, Mar 2016]
Uniprot Description
Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient (PubMed:26358773). Plays an important role in signal transduction.
Research Articles on SLC9A3
Similar Products
Product Notes
The SLC9A3 slc9a3 (Catalog #AAA3207077) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC9A3 antibody - middle region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC9A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC9A3 slc9a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEDMVTHHTL QQYLYKPRQE YKHLYSRHEL TPTEDEKQDR EIFHRTMRKR. It is sometimes possible for the material contained within the vial of "SLC9A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
