Rabbit SLC7A7 Polyclonal Antibody | anti-SLC7A7 antibody

SLC7A7 antibody - middle region

Cat. Num. AAA3207072

• Gene Names: SLC7A7; LPI; LAT3; MOP-2; Y+LAT1; y+LAT-1
• Reactivity: Tested Reactivity: Human; Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Purity: Affinity Purified
• Synonyms: SLC7A7; Polyclonal Antibody; SLC7A7 antibody - middle region; anti-SLC7A7 antibody

• Host: Rabbit
• Reactivity: Tested Reactivity: Human; Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
• Sequence: WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI

• Protein Size (# AA): 511 amino acids
• Blocking Peptide: For anti-SLC7A7 (MBS3207072) antibody is Catalog # MBS3232038
• Protein Interactions: NEDD4L; SLC3A2
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC7A7
• Predicted Homology: Cow: 100%; Dog: 86%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 100%; Rat: 79%
• Replacement Item: This antibody may replace item sc-34553 from Santa Cruz Biotechnology.
• Preparation and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-SLC7A7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(Host: RabbitTarget Name: SLC7A7Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SLC7A7Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SLC7A7 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysate)

Related Product Information for anti-SLC7A7 antibody

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.

Product Categories/Family for anti-SLC7A7 antibody

Polyclonal; Membrane Protein; Drugs and Drug Metabolism; Cell Biology; Membrane & Traffic

NCBI and Uniprot Product Information

• NCBI GI #: 186910304
• NCBI GeneID: 9056
• NCBI Accession #: NP_003973
• NCBI GenBank Nucleotide #: NM_003982
• UniProt Accession #: Q9UM01
• Molecular Weight: 56kDa
• NCBI Official Synonym Full Names: solute carrier family 7 member 7
• NCBI Official Symbol: SLC7A7
• NCBI Official Synonym Symbols: LPI; LAT3; MOP-2; Y+LAT1; y+LAT-1
• NCBI Protein Information: Y+L amino acid transporter 1
• UniProt Protein Name: Y+L amino acid transporter 1
• Protein Family: Y+L amino acid transporter
• UniProt Gene Name: SLC7A7
• UniProt Synonym Gene Names: MOP-2; Y+LAT1; y+LAT-1

NCBI Description

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2011]

Uniprot Description

Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires coexpression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Involved in the transport of L-arginine in monocytes.