Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC7A1 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateSLC7A1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Rabbit SLC7A1 Polyclonal Antibody | anti-SLC7A1 antibody

SLC7A1 antibody - N-terminal region

Gene Names
SLC7A1; ERR; ATRC1; CAT-1; HCAT1; REC1L
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC7A1; Polyclonal Antibody; SLC7A1 antibody - N-terminal region; anti-SLC7A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLNA
Sequence Length
629
Applicable Applications for anti-SLC7A1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 79%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC7A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC7A1 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateSLC7A1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Western Blot (WB) (WB Suggested Anti-SLC7A1 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateSLC7A1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)
Related Product Information for anti-SLC7A1 antibody
This is a rabbit polyclonal antibody against SLC7A1. It was validated on Western Blot

Target Description: SLC7A1 is a high-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. It may also function as an ecotropic retroviral leukemia receptor.
Product Categories/Family for anti-SLC7A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
high affinity cationic amino acid transporter 1
NCBI Official Synonym Full Names
solute carrier family 7 member 1
NCBI Official Symbol
SLC7A1
NCBI Official Synonym Symbols
ERR; ATRC1; CAT-1; HCAT1; REC1L
NCBI Protein Information
high affinity cationic amino acid transporter 1
UniProt Protein Name
High affinity cationic amino acid transporter 1
UniProt Gene Name
SLC7A1
UniProt Synonym Gene Names
ATRC1; ERR; REC1L; CAT-1; CAT1; ERR
UniProt Entry Name
CTR1_HUMAN

Uniprot Description

SLC7A1: High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues. May also function as an ecotropic retroviral leukemia receptor. Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.

Protein type: Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, SLC family

Chromosomal Location of Human Ortholog: 13q12.3

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: arginine transmembrane transporter activity

Biological Process: transport; amino acid transport; arginine transport; ion transport; transmembrane transport

Research Articles on SLC7A1

Similar Products

Product Notes

The SLC7A1 slc7a1 (Catalog #AAA3207057) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC7A1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC7A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC7A1 slc7a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELWAFITGWN LILSYIIGTS SVARAWSATF DELIGRPIGE FSRTHMTLNA. It is sometimes possible for the material contained within the vial of "SLC7A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.