Rabbit TXN2 Polyclonal Antibody | anti-TXN2 antibody

TXN2 antibody - middle region

Cat. Num. AAA3211935

• Gene Names: TXN2; TXN; MTRX; TRX2; MT-TRX; COXPD29
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: TXN2; Polyclonal Antibody; TXN2 antibody - middle region; anti-TXN2 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLI
• Sequence Length: 166

• Applicable Applications for anti-TXN2 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TXN2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TXN2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-TXN2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-TXN2 antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:200Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-TXN2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Related Product Information for anti-TXN2 antibody

This is a rabbit polyclonal antibody against TXN2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TXN2 is a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. TXN2 may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis.This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-TXN2 antibody

Polyclonal; Drugs and Drug Metabolism; Chromatin & Nuclear Signaling; Various; Apoptosis; Membrane & Traffic; Hypoxia

NCBI and Uniprot Product Information

• NCBI GI #: 21361403
• NCBI GeneID: 25828
• NCBI Accession #: NP_036605
• NCBI GenBank Nucleotide #: NM_012473
• UniProt Accession #: Q99757
• Molecular Weight: 12kDa
• NCBI Official Full Name: thioredoxin, mitochondrial
• NCBI Official Synonym Full Names: thioredoxin 2
• NCBI Official Symbol: TXN2
• NCBI Official Synonym Symbols: TXN; MTRX; TRX2; MT-TRX; COXPD29
• NCBI Protein Information: thioredoxin, mitochondrial
• UniProt Protein Name: Thioredoxin, mitochondrial
• UniProt Gene Name: TXN2
• UniProt Synonym Gene Names: TRX2; MTRX; Mt-Trx
• UniProt Entry Name: THIOM_HUMAN

NCBI Description

This nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. [provided by RefSeq, Jul 2008]

Uniprot Description

TXN2: Has an anti-apoptotic function and plays an important role in the regulation of mitochondrial membrane potential. Could be involved in the resistance to anti-tumor agents. Possesses a dithiol-reducing activity. Belongs to the thioredoxin family.

Protein type: Oxidoreductase

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: cell soma; mitochondrion; mitochondrial matrix; dendrite; nucleolus

Molecular Function: peptide-methionine-(S)-S-oxide reductase activity; protein disulfide oxidoreductase activity; protein complex binding; peptide-methionine (R)-S-oxide reductase activity

Biological Process: response to drug; response to reactive oxygen species; cellular response to nutrient levels; cell redox homeostasis; response to glucose stimulus; response to hormone stimulus; response to hypoxia; response to axon injury; response to organic cyclic substance; response to nutrient; glycerol ether metabolic process