Western Blot (WB)
(Host: RabbitTarget Name: SLC35C1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit SLC35C1 Polyclonal Antibody | anti-SLC35C1 antibody
SLC35C1 Antibody - C-terminal region
Gene Names
SLC35C1; CDG2C; FUCT1
Reactivity
Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC35C1; Polyclonal Antibody; SLC35C1 Antibody - C-terminal region; anti-SLC35C1 antibody
Host
Rabbit
Reactivity
Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTG
Sequence Length
364
Applicable Applications for anti-SLC35C1 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35C1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SLC35C1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SLC35C1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC35C1 antibody
This is a rabbit polyclonal antibody against SLC35C1. It was validated on Western Blot
Target Description: This gene encodes a GDP-fucose transporter that is found in the Golgi apparatus. Mutations in this gene result in congenital disorder of glycosylation type IIc. Multiple transcript variants encoding different isoforms have been found for this gene.
Target Description: This gene encodes a GDP-fucose transporter that is found in the Golgi apparatus. Mutations in this gene result in congenital disorder of glycosylation type IIc. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SLC35C1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
GDP-fucose transporter 1 isoform b
NCBI Official Synonym Full Names
solute carrier family 35 member C1
NCBI Official Symbol
SLC35C1
NCBI Official Synonym Symbols
CDG2C; FUCT1
NCBI Protein Information
GDP-fucose transporter 1
UniProt Protein Name
GDP-fucose transporter 1
UniProt Gene Name
SLC35C1
UniProt Synonym Gene Names
FUCT1
UniProt Entry Name
FUCT1_HUMAN
NCBI Description
This gene encodes a GDP-fucose transporter that is found in the Golgi apparatus. Mutations in this gene result in congenital disorder of glycosylation type IIc. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
Research Articles on SLC35C1
Similar Products
Product Notes
The SLC35C1 slc35c1 (Catalog #AAA3207146) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC35C1 Antibody - C-terminal region reacts with Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC35C1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC35C1 slc35c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VNACILFLPL LLLLGELQAL RDFAQLGSAH FWGMMTLGGL FGFAIGYVTG. It is sometimes possible for the material contained within the vial of "SLC35C1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
