Western Blot (WB)
(Host: RabbitTarget Name: SLC22A14Sample Type: Jurkat Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit SLC22A14 Polyclonal Antibody | anti-SLC22A14 antibody
SLC22A14 Antibody - N-terminal region
Gene Names
SLC22A14; OCTL2; OCTL4; ORCTL4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC22A14; Polyclonal Antibody; SLC22A14 Antibody - N-terminal region; anti-SLC22A14 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYP
Sequence Length
594
Applicable Applications for anti-SLC22A14 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC22A14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SLC22A14Sample Type: Jurkat Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SLC22A14Sample Type: Jurkat Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC22A14 antibody
This is a rabbit polyclonal antibody against SLC22A14. It was validated on Western Blot
Target Description: SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.
Target Description: SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.
Product Categories/Family for anti-SLC22A14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
solute carrier family 22 member 14
NCBI Official Synonym Full Names
solute carrier family 22 member 14
NCBI Official Symbol
SLC22A14
NCBI Official Synonym Symbols
OCTL2; OCTL4; ORCTL4
NCBI Protein Information
solute carrier family 22 member 14
UniProt Protein Name
Solute carrier family 22 member 14
Protein Family
UniProt Gene Name
SLC22A14
UniProt Synonym Gene Names
ORCTL4; ORCTL-4
UniProt Entry Name
S22AE_HUMAN
NCBI Description
This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 3. The encoded protein is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Research Articles on SLC22A14
Similar Products
Product Notes
The SLC22A14 slc22a14 (Catalog #AAA3207091) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC22A14 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC22A14 slc22a14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEQLNLTIPQ APNGSFLTCF MYLPVPWNLD SIIQFGLNDT DTCQDGWIYP. It is sometimes possible for the material contained within the vial of "SLC22A14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
