Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SPIT2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SPINT2 Polyclonal Antibody | anti-SPINT2 antibody

SPINT2 Antibody - middle region

Gene Names
SPINT2; PB; Kop; HAI2; DIAR3; HAI-2
Reactivity
Cow, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity purified
Synonyms
SPINT2; Polyclonal Antibody; SPINT2 Antibody - middle region; anti-SPINT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRA
Sequence Length
252
Applicable Applications for anti-SPINT2 antibody
Western Blot (WB)
Homology
Cow: 86%; Horse: 79%; Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SPIT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SPIT2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SPIT2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SPINT2 antibody
This is a rabbit polyclonal antibody against SPIT2. It was validated on Western Blot

Target Description: This gene encodes a transmembrane protein with two extracellular Kunitz domains that inhibits a variety of serine proteases. The protein inhibits HGF activator which prevents the formation of active hepatocyte growth factor. This gene is a putative tumor suppressor, and mutations in this gene result in congenital sodium diarrhea. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SPINT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
kunitz-type protease inhibitor 2 isoform a
NCBI Official Synonym Full Names
serine peptidase inhibitor, Kunitz type 2
NCBI Official Symbol
SPINT2
NCBI Official Synonym Symbols
PB; Kop; HAI2; DIAR3; HAI-2
NCBI Protein Information
kunitz-type protease inhibitor 2
UniProt Protein Name
Kunitz-type protease inhibitor 2
UniProt Gene Name
SPINT2
UniProt Synonym Gene Names
HAI2; KOP; HAI-2
UniProt Entry Name
SPIT2_HUMAN

NCBI Description

This gene encodes a transmembrane protein with two extracellular Kunitz domains that inhibits a variety of serine proteases. The protein inhibits HGF activator which prevents the formation of active hepatocyte growth factor. This gene is a putative tumor suppressor, and mutations in this gene result in congenital sodium diarrhea. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

SPINT2: Inhibitor of HGF activator. Also inhibits plasmin, plasma and tissue kallikrein, and factor XIa. Defects in SPINT2 are the cause of diarrhea type 3 (DIAR3); also known as congenital sodium diarrhea (CSD). DIAR3 is a rare, inherited diarrhea of infancy. A diagnosis of DIAR3 is made on the findings of a life-threatening secretory diarrhea, severe metabolic acidosis, and hyponatremia secondary to extraordinarily high fecal losses of sodium, with low or normal excretion of urinary sodium, in the absence of infectious, autoimmune, and endocrine causes. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Inhibitor; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: cytoplasm; extracellular region

Molecular Function: endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity

Biological Process: cell motility; negative regulation of cell-cell adhesion

Disease: Diarrhea 3, Secretory Sodium, Congenital, With Or Without Other Congenital Anomalies

Research Articles on SPINT2

Similar Products

Product Notes

The SPINT2 spint2 (Catalog #AAA3209536) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SPINT2 Antibody - middle region reacts with Cow, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's SPINT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPINT2 spint2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATGDLATSRN AADSSVPSAP RRQDSEDHSS DMFNYEEYCT ANAVTGPCRA. It is sometimes possible for the material contained within the vial of "SPINT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.