Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC25A10Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SLC25A10 Polyclonal Antibody | anti-SLC25A10 antibody

SLC25A10 Antibody - middle region

Gene Names
SLC25A10; DIC
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC25A10; Polyclonal Antibody; SLC25A10 Antibody - middle region; anti-SLC25A10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRL
Sequence Length
287
Applicable Applications for anti-SLC25A10 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SLC25A10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC25A10Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC25A10Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SLC25A10 antibody
This gene encodes a member of a family of proteins that translocate small metabolites across the mitochondrial membrane. The encoded protein exchanges dicarboxylates, such as malate and succinate, for phosphate, sulfate, and other small molecules, thereby providing substrates for metabolic processes including the Krebs cycle and fatty acid synthesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-SLC25A10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
mitochondrial dicarboxylate carrier isoform 1
NCBI Official Synonym Full Names
solute carrier family 25 member 10
NCBI Official Symbol
SLC25A10
NCBI Official Synonym Symbols
DIC
NCBI Protein Information
mitochondrial dicarboxylate carrier
UniProt Protein Name
Mitochondrial dicarboxylate carrier
UniProt Gene Name
SLC25A10
UniProt Synonym Gene Names
DIC
UniProt Entry Name
DIC_HUMAN

NCBI Description

This gene encodes a member of a family of proteins that translocate small metabolites across the mitochondrial membrane. The encoded protein exchanges dicarboxylates, such as malate and succinate, for phosphate, sulfate, and other small molecules, thereby providing substrates for metabolic processes including the Krebs cycle and fatty acid synthesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]

Uniprot Description

SLC25A10: Involved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane. Belongs to the mitochondrial carrier family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Transporter; Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: mitochondrial inner membrane; integral to membrane; nucleus

Molecular Function: protein binding; dicarboxylic acid transmembrane transporter activity

Biological Process: sulfur amino acid metabolic process; dicarboxylic acid transport; sulfur amino acid catabolic process; carbohydrate metabolic process; glucose metabolic process; ion transport; pathogenesis; transmembrane transport; mitochondrial transport; gluconeogenesis

Research Articles on SLC25A10

Similar Products

Product Notes

The SLC25A10 slc25a10 (Catalog #AAA3222036) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A10 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC25A10 slc25a10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAGGFVGTPA DLVNVRMQND VKLPQGQRRN YAHALDGLYR VAREEGLRRL. It is sometimes possible for the material contained within the vial of "SLC25A10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.