Rabbit anti-Human UCP3 Polyclonal Antibody | anti-UCP3 antibody

UCP3 Antibody - middle region

Cat. Num. AAA3221503

• Gene Names: UCP3; SLC25A9
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: UCP3; Polyclonal Antibody; UCP3 Antibody - middle region; anti-UCP3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: CTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREE
• Sequence Length: 275

• Applicable Applications for anti-UCP3 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCP3
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: UCP3Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-UCP3 antibody

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. The different UCPs have tissue-specific expression; this gene is primarily expressed in skeletal muscle. This gene's protein product is postulated to protect mitochondria against lipid-induced oxidative stress. Expression levels of this gene increase when fatty acid supplies to mitochondria exceed their oxidation capacity and the protein enables the export of fatty acids from mitochondria. UCPs contain the three solcar protein domains typically found in MACPs. Two splice variants have been found for this gene.

Product Categories/Family for anti-UCP3 antibody

Polyclonal; Ion Channel; Cell Biology; Mitochondria; Tissue Specific & Cell Marker

NCBI and Uniprot Product Information

• NCBI GI #: 4507807
• NCBI GeneID: 7352
• NCBI Accession #: NP_003347.1
• NCBI GenBank Nucleotide #: NM_003356.3
• UniProt Accession #: P55916
• Molecular Weight: 30 kDa
• NCBI Official Full Name: mitochondrial uncoupling protein 3 isoform UCP3L
• NCBI Official Synonym Full Names: uncoupling protein 3
• NCBI Official Symbol: UCP3
• NCBI Official Synonym Symbols: SLC25A9
• NCBI Protein Information: mitochondrial uncoupling protein 3
• UniProt Protein Name: Mitochondrial uncoupling protein 3
• Protein Family: UBA domain-containing protein
• UniProt Gene Name: UCP3
• UniProt Synonym Gene Names: SLC25A9; UCP 3
• UniProt Entry Name: UCP3_HUMAN

NCBI Description

Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. The different UCPs have tissue-specific expression; this gene is primarily expressed in skeletal muscle. This gene's protein product is postulated to protect mitochondria against lipid-induced oxidative stress. Expression levels of this gene increase when fatty acid supplies to mitochondria exceed their oxidation capacity and the protein enables the export of fatty acids from mitochondria. UCPs contain the three solcar protein domains typically found in MACPs. Two splice variants have been found for this gene.[provided by RefSeq, Nov 2008]

Uniprot Description

UCP3: UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. As a result, energy is dissipated in the form of heat. May play a role in the modulation of tissue respiratory control. Participates in thermogenesis and energy balance. Defects in UCP3 may be involved in obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. Belongs to the mitochondrial carrier family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q13.4

Cellular Component: mitochondrion; mitochondrial inner membrane; integral to membrane

Molecular Function: protein binding; transporter activity; oxidative phosphorylation uncoupler activity

Biological Process: response to superoxide; response to glucocorticoid stimulus; respiratory gaseous exchange; fatty acid metabolic process; mitochondrial transport; cellular response to hormone stimulus; response to insulin stimulus; cellular metabolic process; proton transport; response to hypoxia; response to cold; lipid metabolic process; response to activity; response to nutrient; aging

Disease: Obesity