Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SI antibody (MBS839689) used at 1 ug/ml to detect target protein.)

Rabbit SI Polyclonal Antibody | anti-SI antibody

SI antibody

Applications
Western Blot
Purity
Affinity purified
Synonyms
SI; Polyclonal Antibody; SI antibody; Polyclonal SI; Anti-SI; MGC131622; MGC131621; Sucrase-Isomaltase; Alpha Glucosidase; anti-SI antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SI antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1827
Applicable Applications for anti-SI antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the final stage of carbohydrate digestion.
Cross-Reactivity
Human
Immunogen
SI antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SI antibody (MBS839689) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (SI antibody (MBS839689) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SI antibody
Rabbit polyclonal SI antibody
Product Categories/Family for anti-SI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
209 kDa (MW of target protein)
NCBI Official Full Name
sucrase-isomaltase, intestinal
NCBI Official Synonym Full Names
sucrase-isomaltase (alpha-glucosidase)
NCBI Official Symbol
SI
NCBI Protein Information
sucrase-isomaltase, intestinal
UniProt Protein Name
Sucrase-isomaltase, intestinal
Protein Family
UniProt Gene Name
SI
UniProt Entry Name
SUIS_HUMAN

NCBI Description

This gene encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.[provided by RefSeq, Apr 2010]

Uniprot Description

SI: Plays an important role in the final stage of carbohydrate digestion. Isomaltase activity is specific for both alpha-1,4- and alpha-1,6-oligosaccharides. Defects in SI are the cause of congenital sucrase- isomaltase deficiency (CSID); also known as disaccharide intolerance I. CSID is an autosomal recessive intestinal disorder that is clinically characterized by fermentative diarrhea, abdominal pain, and cramps upon ingestion of sugar. The symptoms are the consequence of absent or drastically reduced enzymatic activities of sucrase and isomaltase. The prevalence of CSID is 0.02 % in individuals of European descent and appears to be much higher in Greenland, Alaskan, and Canadian native people. CSID arises due to post- translational perturbations in the intracellular transport, polarized sorting, aberrant processing, and defective function of SI. Belongs to the glycosyl hydrolase 31 family.

Protein type: Hydrolase; Membrane protein, integral; EC 3.2.1.10; Carbohydrate Metabolism - starch and sucrose; EC 3.2.1.48

Chromosomal Location of Human Ortholog: 3q25.2-q26.2

Cellular Component: Golgi apparatus; apical plasma membrane; plasma membrane; integral to membrane; brush border

Molecular Function: oligo-1,6-glucosidase activity; alpha-glucosidase activity; sucrose alpha-glucosidase activity; carbohydrate binding

Biological Process: polysaccharide digestion; carbohydrate metabolic process; pathogenesis

Disease: Sucrase-isomaltase Deficiency, Congenital

Research Articles on SI

Similar Products

Product Notes

The SI si (Catalog #AAA839689) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SI si for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.