Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human RABGAP1L Monoclonal Antibody | anti-RABGAP1L antibody

RABGAP1L (HHL, KIAA0471, Rab GTPase-activating Protein 1-like) (AP)

Gene Names
RABGAP1L; HHL; TBC1D18
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RABGAP1L; Monoclonal Antibody; RABGAP1L (HHL; KIAA0471; Rab GTPase-activating Protein 1-like) (AP); anti-RABGAP1L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D3
Specificity
Recognizes human RABGAP1L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
3022
Applicable Applications for anti-RABGAP1L antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from RABGAP1L (NP_055672) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEVRASLQKVSGSSDSVATMNSEEFVLVPQYADDNSTKHEEKPQLKIVSNGDEQLEKAMEEILRDSEKRPSSLLVDCQSSSEISDHSFGDIPASQTNKPSLQLILDPSNT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(RABGAP1L monoclonal antibody. Western Blot analysis of RABGAP1L expression in HepG2)

Western Blot (WB) (RABGAP1L monoclonal antibody. Western Blot analysis of RABGAP1L expression in HepG2)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RABGAP1L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RABGAP1L on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RABGAP1L is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RABGAP1L is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-RABGAP1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens RAB GTPase activating protein 1 like (RABGAP1L), transcript variant 1, mRNA
NCBI Official Synonym Full Names
RAB GTPase activating protein 1 like
NCBI Official Symbol
RABGAP1L
NCBI Official Synonym Symbols
HHL; TBC1D18
NCBI Protein Information
rab GTPase-activating protein 1-like
UniProt Protein Name
Rab GTPase-activating protein 1-like
UniProt Gene Name
RABGAP1L
UniProt Synonym Gene Names
HHL; KIAA0471
UniProt Entry Name
RBG1L_HUMAN

Uniprot Description

Induction: Up-regulated in esophageal squamous cell carcinomas. Expression is strongly inhibited in the medial septum and hippocampus brain regions of some Alzheimer disease patients. Ref.10 Ref.11

Sequence similarities: Contains 1 PID domain.Contains 1 Rab-GAP TBC domain.

Sequence caution: The sequence BAA32316.2 differs from that shown. Reason: Erroneous initiation.

Research Articles on RABGAP1L

Similar Products

Product Notes

The RABGAP1L rabgap1l (Catalog #AAA6133283) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RABGAP1L (HHL, KIAA0471, Rab GTPase-activating Protein 1-like) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RABGAP1L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RABGAP1L rabgap1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RABGAP1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.