Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SH3D19Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlSH3D19 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit SH3D19 Polyclonal Antibody | anti-SH3D19 antibody

SH3D19 Antibody - C-terminal region

Gene Names
SH3D19; EBP; EVE1; Kryn; Eve-1; SH3P19
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SH3D19; Polyclonal Antibody; SH3D19 Antibody - C-terminal region; anti-SH3D19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQV
Sequence Length
420
Applicable Applications for anti-SH3D19 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 92%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SH3D19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SH3D19Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlSH3D19 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (Host: RabbitTarget Name: SH3D19Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlSH3D19 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-SH3D19 antibody
This is a rabbit polyclonal antibody against SH3D19. It was validated on Western Blot

Target Description: This gene encodes a multiple SH3 domain-containing protein, which interacts with other proteins, such as EBP and members of ADAM family, via the SH3 domains. This protein may be involved in suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1 by EBP, and regulation of ADAM proteins in the signaling of EGFR-ligand shedding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SH3D19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
SH3 domain-containing protein 19 isoform 2
NCBI Official Synonym Full Names
SH3 domain containing 19
NCBI Official Symbol
SH3D19
NCBI Official Synonym Symbols
EBP; EVE1; Kryn; Eve-1; SH3P19
NCBI Protein Information
SH3 domain-containing protein 19
UniProt Protein Name
SH3 domain-containing protein 19
UniProt Gene Name
SH3D19
UniProt Entry Name
SH319_HUMAN

NCBI Description

This gene encodes a multiple SH3 domain-containing protein, which interacts with other proteins, such as EBP and members of ADAM family, via the SH3 domains. This protein may be involved in suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1 by EBP, and regulation of ADAM proteins in the signaling of EGFR-ligand shedding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Research Articles on SH3D19

Similar Products

Product Notes

The SH3D19 sh3d19 (Catalog #AAA3217429) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SH3D19 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SH3D19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SH3D19 sh3d19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRVHLSQMKI ITPLDEHLRS RPNDPSHAQK PVDSGAPHAV VLHDFPAEQV. It is sometimes possible for the material contained within the vial of "SH3D19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.