Western Blot (WB)
(Host: RabbitTarget Name: WBP5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit TCEAL9 Polyclonal Antibody | anti-TCEAL9 antibody
TCEAL9 Antibody - N-terminal region
Gene Names
TCEAL9; WBP5; WEX6
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCEAL9; Polyclonal Antibody; TCEAL9 Antibody - N-terminal region; anti-TCEAL9 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQ
Sequence Length
104
Applicable Applications for anti-TCEAL9 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 86%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 86%; Rat: 92%; Yeast: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human WBP5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: WBP5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: WBP5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TCEAL9 antibody
This is a rabbit polyclonal antibody against WBP5. It was validated on Western Blot
Target Description: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform.
Target Description: The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform.
Product Categories/Family for anti-TCEAL9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
transcription elongation factor A protein-like 9
NCBI Official Synonym Full Names
transcription elongation factor A like 9
NCBI Official Symbol
TCEAL9
NCBI Official Synonym Symbols
WBP5; WEX6
NCBI Protein Information
transcription elongation factor A protein-like 9
UniProt Protein Name
WW domain-binding protein 5
Protein Family
UniProt Gene Name
WBP5
UniProt Synonym Gene Names
WBP-5
UniProt Entry Name
WBP5_HUMAN
NCBI Description
The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008]
Research Articles on TCEAL9
Similar Products
Product Notes
The TCEAL9 wbp5 (Catalog #AAA3202066) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCEAL9 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TCEAL9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCEAL9 wbp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKMEGKPENE SEPKHEEEPK PEEKPEEEEK LEEEAKAKGT FRERLIQSLQ. It is sometimes possible for the material contained within the vial of "TCEAL9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
