Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: REPS2Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlREPS2 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit REPS2 Polyclonal Antibody | anti-REPS2 antibody

REPS2 Antibody - C-terminal region

Gene Names
REPS2; POB1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
REPS2; Polyclonal Antibody; REPS2 Antibody - C-terminal region; anti-REPS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDVLYSQPPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQK
Sequence Length
521
Applicable Applications for anti-REPS2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 80%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human REPS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: REPS2Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlREPS2 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: REPS2Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlREPS2 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-REPS2 antibody
This is a rabbit polyclonal antibody against REPS2. It was validated on Western Blot

Target Description: The product of this gene is part of a protein complex that regulates the endocytosis of growth factor receptors. The encoded protein directly interacts with a GTPase activating protein that functions downstream of the small G protein Ral. Its expression can negatively affect receptor internalization and inhibit growth factor signaling. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-REPS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
ralBP1-associated Eps domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
RALBP1 associated Eps domain containing 2
NCBI Official Symbol
REPS2
NCBI Official Synonym Symbols
POB1
NCBI Protein Information
ralBP1-associated Eps domain-containing protein 2
UniProt Protein Name
RalBP1-associated Eps domain-containing protein 2
UniProt Gene Name
REPS2
UniProt Synonym Gene Names
POB1
UniProt Entry Name
REPS2_HUMAN

NCBI Description

The product of this gene is part of a protein complex that regulates the endocytosis of growth factor receptors. The encoded protein directly interacts with a GTPase activating protein that functions downstream of the small G protein Ral. Its expression can negatively affect receptor internalization and inhibit growth factor signaling. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

REPS2: an adaptor protein involved in growth factor signaling through its influence on the Ral, a small G protein that regulates endocytosis of EGF and insulin receptors. Interacts with DDEF1, paxillin, RALBP1 and GRB2. Binding to RALBP1 does not affect the Ral-binding activity of the latter. Forms a ternary complex with activated Ral and RALBP1. Binds epsin 1. Relatively highly expressed in androgen-dependent as compared to androgen-independent prostate cancer cell lines and xenografts. EGF receptor internalization and signalling is inhibited by increased expression of REPS2. EGF stimulates phosphorylation on Tyr-residues and induces complex formation with EGF receptor through an adapter protein such as GRB2. Two alternatively spliced isoforms have been described. Isoform 2 is down-regulated during progression of prostate cancer.

Protein type: Adaptor/scaffold; G protein regulator, misc.

Chromosomal Location of Human Ortholog: Xp22.2

Cellular Component: cytoplasm

Molecular Function: protein binding; calcium ion binding

Biological Process: epidermal growth factor receptor signaling pathway; protein complex assembly

Research Articles on REPS2

Similar Products

Product Notes

The REPS2 reps2 (Catalog #AAA3216632) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The REPS2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's REPS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the REPS2 reps2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDVLYSQPPS KPIRRKFRPE NQATENQEPS TAASGPASAA TMKPHPTVQK. It is sometimes possible for the material contained within the vial of "REPS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.