CD69 recombinant protein

CD69 Recombinant Protein

Cat. Num. AAA3003692

• Gene Names: CD69; AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD69; CD69 Recombinant Protein; CD69 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: SVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 426
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD69 recombinant protein

Background: CD69, also known as Leu-23, is a type II transmembrane glycoprotein that is expressed on the surface of T cells, B cells, and NK cells. This phosphorylated disulfide-linked 28 to 32-kDa homodimer is constitutively expressed on a subset of thymocytes and platelets. It also acts as an activation antigen of lymphocytes, NK cells, neutrophils, and eosinophils. Studies have shown that stimulation of the T cell receptor (TCR) increases the expression of CD69 on the cell surface. The ability to detect the level of CD69 expression after TCR activation makes CD69 an ideal indicator of T cell activation. The FN50 antibody is widely used as a marker for T cell activation.

NCBI and Uniprot Product Information

• NCBI GI #: 584906
• NCBI GeneID: 969
• UniProt Accession #: Q07108
• Molecular Weight: 22,559 Da
• NCBI Official Full Name: Early activation antigen CD69
• NCBI Official Synonym Full Names: CD69 molecule
• NCBI Official Symbol: CD69
• NCBI Official Synonym Symbols: AIM; EA1; MLR-3; CLEC2C; GP32/28; BL-AC/P26
• NCBI Protein Information: early activation antigen CD69; leukocyte surface antigen Leu-23; early T-cell activation antigen p60; early lymphocyte activation antigen; activation inducer molecule (AIM/CD69); C-type lectin domain family 2, member C; CD69 antigen (p60, early T-cell act
• UniProt Protein Name: Early activation antigen CD69
• Protein Family: Early activation antigen
• UniProt Gene Name: CD69
• UniProt Synonym Gene Names: CLEC2C; AIM
• UniProt Entry Name: CD69_HUMAN

NCBI Description

This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. [provided by RefSeq, Aug 2011]

Uniprot Description

Function: Involved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.

Subunit structure: Homodimer; disulfide-linked. Ref.6 Ref.7 Ref.8

Subcellular location: Membrane; Single-pass type II membrane protein.

Tissue specificity: Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.

Developmental stage: Earliest inducible cell surface glycoprotein acquired during lymphoid activation.

Induction: By antigens, mitogens or activators of PKC on the surface of T and B-lymphocytes. By interaction of IL-2 with the p75 IL-2R on the surface of NK cells.

Post-translational modification: Constitutive Ser/Thr phosphorylation in both mature thymocytes and activated T-lymphocytes.

Sequence similarities: Contains 1 C-type lectin domain.