Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PTGFRSample Type: Human 721_BAntibody Dilution: 1.0ug/mlPTGFR is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit PTGFR Polyclonal Antibody | anti-PTGFR antibody

PTGFR Antibody - C-terminal region

Gene Names
PTGFR; FP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTGFR; Polyclonal Antibody; PTGFR Antibody - C-terminal region; anti-PTGFR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFYLLLFSFLGLLALGVSLLCNAITGITLLRVKFKSQQHRQGRSHHLEMV
Sequence Length
359
Applicable Applications for anti-PTGFR antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PTGFR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PTGFRSample Type: Human 721_BAntibody Dilution: 1.0ug/mlPTGFR is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: PTGFRSample Type: Human 721_BAntibody Dilution: 1.0ug/mlPTGFR is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-PTGFR AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)

Western Blot (WB) (WB Suggested Anti-PTGFR AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Related Product Information for anti-PTGFR antibody
This is a rabbit polyclonal antibody against PTGFR. It was validated on Western Blot

Target Description: The protein encoded by this gene is member of the G-protein coupled receptor family. This protein is a receptor for prostaglandin F2-alpha (PGF2-alpha), which is known to be a potent luteolytic agent, and may also be involved in modulating intraocular pressure and smooth muscle contraction in uterus. Knockout studies in mice suggest that the interaction of PGF2-alpha with this receptor may initiate parturition in ovarian luteal cells and thus induce luteolysis. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PTGFR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
prostaglandin F2-alpha receptor isoform a
NCBI Official Synonym Full Names
prostaglandin F receptor
NCBI Official Symbol
PTGFR
NCBI Official Synonym Symbols
FP
NCBI Protein Information
prostaglandin F2-alpha receptor
UniProt Protein Name
Prostaglandin F2-alpha receptor
UniProt Gene Name
PTGFR
UniProt Synonym Gene Names
PGF receptor
UniProt Entry Name
PF2R_HUMAN

NCBI Description

The protein encoded by this gene is member of the G-protein coupled receptor family. This protein is a receptor for prostaglandin F2-alpha (PGF2-alpha), which is known to be a potent luteolytic agent, and may also be involved in modulating intraocular pressure and smooth muscle contraction in uterus. Knockout studies in mice suggest that the interaction of PGF2-alpha with this receptor may initiate parturition in ovarian luteal cells and thus induce luteolysis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PTGFR: Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 1p31.1

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane; extracellular region

Molecular Function: prostaglandin F receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; positive regulation of cell proliferation; response to lipopolysaccharide; parturition; negative regulation of apoptosis

Research Articles on PTGFR

Similar Products

Product Notes

The PTGFR ptgfr (Catalog #AAA3216652) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTGFR Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's PTGFR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTGFR ptgfr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFYLLLFSFL GLLALGVSLL CNAITGITLL RVKFKSQQHR QGRSHHLEMV. It is sometimes possible for the material contained within the vial of "PTGFR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.