Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SEP15 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit SELENOF Polyclonal Antibody | anti-SELENOF antibody

SELENOF Antibody - middle region

Gene Names
SELENOF; SEP15
Reactivity
Cow, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SELENOF; Polyclonal Antibody; SELENOF Antibody - middle region; anti-SELENOF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS
Sequence Length
165
Applicable Applications for anti-SELENOF antibody
Western Blot (WB)
Homology
Cow: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SEP15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SEP15 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-SEP15 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-SELENOF antibody
This is a rabbit polyclonal antibody against SEP15. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene belongs to the SEP15/selenoprotein M family. The exact function of this protein is not known; however, it has been found to associate with UDP-glucose:glycoprotein glucosyltransferase (UGTR), an endoplasmic reticulum(ER)-resident protein, which is involved in the quality control of protein folding. The association with UGTR retains this protein in the ER, where it may play a role in protein folding. It has also been suggested to have a role in cancer etiology. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-SELENOF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
selenoprotein F isoform 1
NCBI Official Synonym Full Names
selenoprotein F
NCBI Official Symbol
SELENOF
NCBI Official Synonym Symbols
SEP15
NCBI Protein Information
selenoprotein F
UniProt Protein Name
15 kDa selenoprotein
UniProt Gene Name
SEP15
UniProt Entry Name
SEP15_HUMAN

NCBI Description

The protein encoded by this gene belongs to the SEP15/selenoprotein M family. The exact function of this protein is not known; however, it has been found to associate with UDP-glucose:glycoprotein glucosyltransferase (UGTR), an endoplasmic reticulum(ER)-resident protein, which is involved in the quality control of protein folding. The association with UGTR retains this protein in the ER, where it may play a role in protein folding. It has also been suggested to have a role in cancer etiology. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2016]

Uniprot Description

SEP15: May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum. Belongs to the selenoprotein M/SEP15 family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1p31

Cellular Component: endoplasmic reticulum lumen

Molecular Function: selenium binding

Biological Process: 'de novo' posttranslational protein folding

Research Articles on SELENOF

Similar Products

Product Notes

The SELENOF sep15 (Catalog #AAA3208941) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SELENOF Antibody - middle region reacts with Cow, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SELENOF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SELENOF sep15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDKPKLFRGL QIKYVRGSDP VLKLLDDNGN IAEELSILKW NTDSVEEFLS. It is sometimes possible for the material contained within the vial of "SELENOF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.