Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ICT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

Rabbit MRPL58 Polyclonal Antibody | anti-MRPL58 antibody

MRPL58 Antibody - middle region

Gene Names
MRPL58; DS1; DS-1; ICT1; MRP-L58
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRPL58; Polyclonal Antibody; MRPL58 Antibody - middle region; anti-MRPL58 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM
Sequence Length
206
Applicable Applications for anti-MRPL58 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ICT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ICT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-ICT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Related Product Information for anti-MRPL58 antibody
This is a rabbit polyclonal antibody against ICT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be responsible for degrading prematurely-terminated polypeptides and for reusing stalled ribosomes. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-MRPL58 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
peptidyl-tRNA hydrolase ICT1, mitochondrial isoform 1
NCBI Official Synonym Full Names
mitochondrial ribosomal protein L58
NCBI Official Symbol
MRPL58
NCBI Official Synonym Symbols
DS1; DS-1; ICT1; MRP-L58
NCBI Protein Information
peptidyl-tRNA hydrolase ICT1, mitochondrial
UniProt Protein Name
Peptidyl-tRNA hydrolase ICT1, mitochondrial
Protein Family
UniProt Gene Name
ICT1
UniProt Synonym Gene Names
DS1; MRP-L58; DS-1
UniProt Entry Name
ICT1_HUMAN

NCBI Description

The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be responsible for degrading prematurely-terminated polypeptides and for reusing stalled ribosomes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]

Uniprot Description

ICT1: Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes. Belongs to the prokaryotic/mitochondrial release factor family. ICT1 subfamily.

Protein type: Mitochondrial; EC 3.1.1.29

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: mitochondrion; mitochondrial matrix; mitochondrial inner membrane; mitochondrial large ribosomal subunit

Molecular Function: aminoacyl-tRNA hydrolase activity; translation release factor activity, codon nonspecific

Biological Process: mitochondrial translation; organelle organization and biogenesis

Research Articles on MRPL58

Similar Products

Product Notes

The MRPL58 ict1 (Catalog #AAA3211748) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRPL58 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MRPL58 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRPL58 ict1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEWIAEPVRQ KIAITHKNKI NRLGELILTS ESSRYQFRNL ADCLQKIRDM. It is sometimes possible for the material contained within the vial of "MRPL58, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.