Western Blot (WB)
(WB Suggested Anti-PNRC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Rabbit PNRC2 Polyclonal Antibody | anti-PNRC2 antibody
PNRC2 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PNRC2; Polyclonal Antibody; PNRC2 antibody - middle region; anti-PNRC2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN
Sequence Length
139
Applicable Applications for anti-PNRC2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PNRC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PNRC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-PNRC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Related Product Information for anti-PNRC2 antibody
This is a rabbit polyclonal antibody against PNRC2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PNRC2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery.PNRC2 may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. PNRC2 is required for UPF1/RENT1 localization to the P-body. PNRC2 also acts as a nuclear receptor coactivator. PNRC2 may play a role in controlling the energy balance between energy storage and energy expenditure.
Target Description: PNRC2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery.PNRC2 may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. PNRC2 is required for UPF1/RENT1 localization to the P-body. PNRC2 also acts as a nuclear receptor coactivator. PNRC2 may play a role in controlling the energy balance between energy storage and energy expenditure.
Product Categories/Family for anti-PNRC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
proline-rich nuclear receptor coactivator 2
NCBI Official Synonym Full Names
proline rich nuclear receptor coactivator 2
NCBI Official Symbol
PNRC2
NCBI Protein Information
proline-rich nuclear receptor coactivator 2
UniProt Protein Name
Proline-rich nuclear receptor coactivator 2
Protein Family
UniProt Gene Name
PNRC2
UniProt Entry Name
PNRC2_HUMAN
Uniprot Description
PNRC2: Involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. Required for UPF1/RENT1 localization to the P-body. Also acts as a nuclear receptor coactivator. May play a role in controlling the energy balance between energy storage and energy expenditure. Belongs to the PNRC family. PNRC2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Transcription regulation; Nuclear receptor co-regulator
Chromosomal Location of Human Ortholog: 1p36.11
Cellular Component: nucleus
Molecular Function: protein binding
Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent; deadenylation-independent decapping; mRNA catabolic process, nonsense-mediated decay
Research Articles on PNRC2
Similar Products
Product Notes
The PNRC2 pnrc2 (Catalog #AAA3213137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNRC2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PNRC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PNRC2 pnrc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NQSWNSSLSG PRLLFKSQAN QNYAGAKFSE PPSPSVLPKP PSHWVPVSFN. It is sometimes possible for the material contained within the vial of "PNRC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
